Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX142678.1 | internal | 167 | 1-501(+) |
Amino Acid sequence : | |||
ARALTKQIKTIKMSLVPFGFGSRVFDPSSSFDLWDPIDSFFRDVVPRANSSFPSETSAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERS SGKFLRRFRMPENAKVEEVRASMENGVLTVTVPKAEVKKPEVKSIDI | |||
Physicochemical properties | |||
Number of amino acids: | 167 | ||
Molecular weight: | 18,404.104 | ||
Theoretical pI: | 9.042 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 63.418 | ||
aromaticity | 0.037 | ||
GRAVY | -0.253 | ||
Secondary Structure Fraction | |||
Helix | 0.344 | ||
turn | 0.239 | ||
sheet | 0.337 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX142678.1 | 3prime_partial | 166 | 500-3(-) |
Amino Acid sequence : | |||
MSMDLTSGFLTSAFGTVTVRTPFSIEALTSSTFAFSGIRNLLRNFPLLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSALNTCASGVSFQSMRVLANAEVSLGKLEFA RGTTSRKKLSMGSQRSKDEEGSNTREPNPNGTSDILIVLICLVNAR | |||
Physicochemical properties | |||
Number of amino acids: | 166 | ||
Molecular weight: | 18,404.104 | ||
Theoretical pI: | 9.042 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 63.418 | ||
aromaticity | 0.037 | ||
GRAVY | -0.253 | ||
Secondary Structure Fraction | |||
Helix | 0.344 | ||
turn | 0.239 | ||
sheet | 0.337 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX142678.1 | 5prime_partial | 163 | 501-10(-) |
Amino Acid sequence : | |||
DVNGFDFRLLNLRLRHGNGKNSVLHRSPHLLHLRVLRHPEPPQKLPAAPLHAVPRVVLLLLLLPPLPADLEDPPLLHFHLHLLLLDSGEVGLEHVRLRRLLPVYAGVGERRSLARKARVR TGNHVAEEAIDGIPEIEGRGGIEHSRTESEWNKRHLDCFDLLG* | |||
Physicochemical properties | |||
Number of amino acids: | 163 | ||
Molecular weight: | 18,404.104 | ||
Theoretical pI: | 9.042 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 63.418 | ||
aromaticity | 0.037 | ||
GRAVY | -0.253 | ||
Secondary Structure Fraction | |||
Helix | 0.344 | ||
turn | 0.239 | ||
sheet | 0.337 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX142678.1 | internal | 167 | 1-501(+) |
Amino Acid sequence : | |||
ARALTKQIKTIKMSLVPFGFGSRVFDPSSSFDLWDPIDSFFRDVVPRANSSFPSETSAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERS SGKFLRRFRMPENAKVEEVRASMENGVLTVTVPKAEVKKPEVKSIDI | |||
Physicochemical properties | |||
Number of amino acids: | 167 | ||
Molecular weight: | 18,404.104 | ||
Theoretical pI: | 9.042 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 63.418 | ||
aromaticity | 0.037 | ||
GRAVY | -0.253 | ||
Secondary Structure Fraction | |||
Helix | 0.344 | ||
turn | 0.239 | ||
sheet | 0.337 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX142678.1 | 3prime_partial | 166 | 500-3(-) |
Amino Acid sequence : | |||
MSMDLTSGFLTSAFGTVTVRTPFSIEALTSSTFAFSGIRNLLRNFPLLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSALNTCASGVSFQSMRVLANAEVSLGKLEFA RGTTSRKKLSMGSQRSKDEEGSNTREPNPNGTSDILIVLICLVNAR | |||
Physicochemical properties | |||
Number of amino acids: | 166 | ||
Molecular weight: | 18,404.104 | ||
Theoretical pI: | 9.042 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 63.418 | ||
aromaticity | 0.037 | ||
GRAVY | -0.253 | ||
Secondary Structure Fraction | |||
Helix | 0.344 | ||
turn | 0.239 | ||
sheet | 0.337 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX142678.1 | 5prime_partial | 163 | 501-10(-) |
Amino Acid sequence : | |||
DVNGFDFRLLNLRLRHGNGKNSVLHRSPHLLHLRVLRHPEPPQKLPAAPLHAVPRVVLLLLLLPPLPADLEDPPLLHFHLHLLLLDSGEVGLEHVRLRRLLPVYAGVGERRSLARKARVR TGNHVAEEAIDGIPEIEGRGGIEHSRTESEWNKRHLDCFDLLG* | |||
Physicochemical properties | |||
Number of amino acids: | 163 | ||
Molecular weight: | 18,404.104 | ||
Theoretical pI: | 9.042 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 63.418 | ||
aromaticity | 0.037 | ||
GRAVY | -0.253 | ||
Secondary Structure Fraction | |||
Helix | 0.344 | ||
turn | 0.239 | ||
sheet | 0.337 |