Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX142684.1 | 5prime_partial | 142 | 2-430(+) |
Amino Acid sequence : | |||
HEVTSGGFMVAFAGRKYAARSLPAFVSNSTYTVTSFTLVLEFQKGTLQNLYWKRDACASCSGKTNFVCLNNLECAIKTSSCKGQQGGSVDCSVGIQLAFSGTDKNDAVLNSWYEVSKLRQ YSLYGLYSDLKSSLTDQFTDIF* | |||
Physicochemical properties | |||
Number of amino acids: | 142 | ||
Molecular weight: | 13,591.832 | ||
Theoretical pI: | 10.072 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27500 27625 | ||
Instability index: | 42.840 | ||
aromaticity | 0.090 | ||
GRAVY | 0.387 | ||
Secondary Structure Fraction | |||
Helix | 0.352 | ||
turn | 0.238 | ||
sheet | 0.262 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX142684.1 | 3prime_partial | 122 | 165-530(+) |
Amino Acid sequence : | |||
MLVLRVPGRQTSFALTIWSVPLKLPAAKASRVARWTAASEFSWHSLVPTRTMLFSTHGTKCLSSVSTLSMDCTPTSRVLSQTNSLTSSNIAHLVWTCLVIFTWSFPHTFPLLLLEDVKNL IM | |||
Physicochemical properties | |||
Number of amino acids: | 122 | ||
Molecular weight: | 13,591.832 | ||
Theoretical pI: | 10.072 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 27500 27625 | ||
Instability index: | 42.840 | ||
aromaticity | 0.090 | ||
GRAVY | 0.387 | ||
Secondary Structure Fraction | |||
Helix | 0.352 | ||
turn | 0.238 | ||
sheet | 0.262 |