Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX142692.1 | internal | 181 | 1-543(+) |
Amino Acid sequence : | |||
VTDNPGLPCFLFGHSTGGAIVLKAVLDPKIEARIEGVVLTSPAIRVQPSHPIVEILAPICSLLVPKYQFSSANNKGPPVSRDPEALKAKYSDPLVFTGAIRIRTGYEILRTSYYLQRNLN RVTVPFLVLHGTSDTVTDPEATQRLYQEASSTDKSIKLYEGFLHDLLFEPERDDIARSIID | |||
Physicochemical properties | |||
Number of amino acids: | 181 | ||
Molecular weight: | 20,004.666 | ||
Theoretical pI: | 6.107 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 10430 10555 | ||
Instability index: | 36.256 | ||
aromaticity | 0.077 | ||
GRAVY | -0.081 | ||
Secondary Structure Fraction | |||
Helix | 0.343 | ||
turn | 0.243 | ||
sheet | 0.232 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX142692.1 | internal | 181 | 1-543(+) |
Amino Acid sequence : | |||
VTDNPGLPCFLFGHSTGGAIVLKAVLDPKIEARIEGVVLTSPAIRVQPSHPIVEILAPICSLLVPKYQFSSANNKGPPVSRDPEALKAKYSDPLVFTGAIRIRTGYEILRTSYYLQRNLN RVTVPFLVLHGTSDTVTDPEATQRLYQEASSTDKSIKLYEGFLHDLLFEPERDDIARSIID | |||
Physicochemical properties | |||
Number of amino acids: | 181 | ||
Molecular weight: | 20,004.666 | ||
Theoretical pI: | 6.107 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 10430 10555 | ||
Instability index: | 36.256 | ||
aromaticity | 0.077 | ||
GRAVY | -0.081 | ||
Secondary Structure Fraction | |||
Helix | 0.343 | ||
turn | 0.243 | ||
sheet | 0.232 |