| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142694.1 | internal | 130 | 1-390(+) |
Amino Acid sequence : | |||
| ARADPKKPLLMAIKAQIYDVTQSRMFYGPGGPYALFAGKDASRALAKMSFEDKDLTGDISGLGPFELEALQDWEYKFMSKYTKVGTIKKSVPETEGPTEAEVTEASTLTTERGLAEGQAE HSAESKEDNT | |||
Physicochemical properties | |||
| Number of amino acids: | 130 | ||
| Molecular weight: | 10,836.245 | ||
| Theoretical pI: | 9.740 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
| Instability index: | 46.693 | ||
| aromaticity | 0.087 | ||
| GRAVY | 0.090 | ||
Secondary Structure Fraction | |||
| Helix | 0.291 | ||
| turn | 0.388 | ||
| sheet | 0.233 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142694.1 | 5prime_partial | 103 | 389-78(-) |
Amino Acid sequence : | |||
| VLSSFDSALCSAWPSARPRSVVRVDASVTSASVGPSVSGTDFFMVPTLVYLLMNLYSQSWRASSSKGPRPDMSPVKSLSSKDIFARALLASLPANNAYGPPGP* | |||
Physicochemical properties | |||
| Number of amino acids: | 103 | ||
| Molecular weight: | 10,836.245 | ||
| Theoretical pI: | 9.740 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
| Instability index: | 46.693 | ||
| aromaticity | 0.087 | ||
| GRAVY | 0.090 | ||
Secondary Structure Fraction | |||
| Helix | 0.291 | ||
| turn | 0.388 | ||
| sheet | 0.233 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142694.1 | internal | 130 | 1-390(+) |
Amino Acid sequence : | |||
| ARADPKKPLLMAIKAQIYDVTQSRMFYGPGGPYALFAGKDASRALAKMSFEDKDLTGDISGLGPFELEALQDWEYKFMSKYTKVGTIKKSVPETEGPTEAEVTEASTLTTERGLAEGQAE HSAESKEDNT | |||
Physicochemical properties | |||
| Number of amino acids: | 130 | ||
| Molecular weight: | 10,836.245 | ||
| Theoretical pI: | 9.740 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
| Instability index: | 46.693 | ||
| aromaticity | 0.087 | ||
| GRAVY | 0.090 | ||
Secondary Structure Fraction | |||
| Helix | 0.291 | ||
| turn | 0.388 | ||
| sheet | 0.233 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142694.1 | 5prime_partial | 103 | 389-78(-) |
Amino Acid sequence : | |||
| VLSSFDSALCSAWPSARPRSVVRVDASVTSASVGPSVSGTDFFMVPTLVYLLMNLYSQSWRASSSKGPRPDMSPVKSLSSKDIFARALLASLPANNAYGPPGP* | |||
Physicochemical properties | |||
| Number of amino acids: | 103 | ||
| Molecular weight: | 10,836.245 | ||
| Theoretical pI: | 9.740 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15470 | ||
| Instability index: | 46.693 | ||
| aromaticity | 0.087 | ||
| GRAVY | 0.090 | ||
Secondary Structure Fraction | |||
| Helix | 0.291 | ||
| turn | 0.388 | ||
| sheet | 0.233 | ||