Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX142695.1 | internal | 121 | 1-363(+) |
Amino Acid sequence : | |||
ARVSVLLFLRKPQLTLSTGSVVEQGNIFSLLIVMKENLLCCCAWWMITVNFVLCQHCKHSNVEWHIQTLDLIILWVGELHQSDASLNCQSGRTLCMRNIRMLYMKNFRRKIKLTNVPMFQ L | |||
Physicochemical properties | |||
Number of amino acids: | 121 | ||
Molecular weight: | 13,927.748 | ||
Theoretical pI: | 7.673 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25565 | ||
Instability index: | 37.513 | ||
aromaticity | 0.133 | ||
GRAVY | -0.389 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.183 | ||
sheet | 0.225 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX142695.1 | internal | 120 | 3-362(+) |
Amino Acid sequence : | |||
TSFGVTVFEKAATYVIHWICGRTGKHLFLTDCDEGKPPLLLRMVDDYGELRFMSALQAFKRRVAYSNVGFDHIVGWRTSSIRRKSELPKWENSLYEKYPHVVYEEFSKEDKADKCADVSI | |||
Physicochemical properties | |||
Number of amino acids: | 120 | ||
Molecular weight: | 13,927.748 | ||
Theoretical pI: | 7.673 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25565 | ||
Instability index: | 37.513 | ||
aromaticity | 0.133 | ||
GRAVY | -0.389 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.183 | ||
sheet | 0.225 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX142695.1 | internal | 121 | 1-363(+) |
Amino Acid sequence : | |||
ARVSVLLFLRKPQLTLSTGSVVEQGNIFSLLIVMKENLLCCCAWWMITVNFVLCQHCKHSNVEWHIQTLDLIILWVGELHQSDASLNCQSGRTLCMRNIRMLYMKNFRRKIKLTNVPMFQ L | |||
Physicochemical properties | |||
Number of amino acids: | 121 | ||
Molecular weight: | 13,927.748 | ||
Theoretical pI: | 7.673 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25565 | ||
Instability index: | 37.513 | ||
aromaticity | 0.133 | ||
GRAVY | -0.389 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.183 | ||
sheet | 0.225 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX142695.1 | internal | 120 | 3-362(+) |
Amino Acid sequence : | |||
TSFGVTVFEKAATYVIHWICGRTGKHLFLTDCDEGKPPLLLRMVDDYGELRFMSALQAFKRRVAYSNVGFDHIVGWRTSSIRRKSELPKWENSLYEKYPHVVYEEFSKEDKADKCADVSI | |||
Physicochemical properties | |||
Number of amino acids: | 120 | ||
Molecular weight: | 13,927.748 | ||
Theoretical pI: | 7.673 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25440 25565 | ||
Instability index: | 37.513 | ||
aromaticity | 0.133 | ||
GRAVY | -0.389 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.183 | ||
sheet | 0.225 |