| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142700.1 | internal | 116 | 3-350(+) |
Amino Acid sequence : | |||
| LDPKIEARIEGVVLTSPAIRVQPSHPIVEILAPICSLLVPKYQFSSANNKGPPVSRDPEALKAKYSDPLVFTGAIRIRTGYEILRTSYYLQRNLNRVTVPFLVLHGTSDTVTDPEA | |||
Physicochemical properties | |||
| Number of amino acids: | 116 | ||
| Molecular weight: | 12,812.630 | ||
| Theoretical pI: | 8.833 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7450 | ||
| Instability index: | 46.030 | ||
| aromaticity | 0.069 | ||
| GRAVY | -0.067 | ||
Secondary Structure Fraction | |||
| Helix | 0.345 | ||
| turn | 0.259 | ||
| sheet | 0.224 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142700.1 | internal | 116 | 3-350(+) |
Amino Acid sequence : | |||
| LDPKIEARIEGVVLTSPAIRVQPSHPIVEILAPICSLLVPKYQFSSANNKGPPVSRDPEALKAKYSDPLVFTGAIRIRTGYEILRTSYYLQRNLNRVTVPFLVLHGTSDTVTDPEA | |||
Physicochemical properties | |||
| Number of amino acids: | 116 | ||
| Molecular weight: | 12,812.630 | ||
| Theoretical pI: | 8.833 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7450 | ||
| Instability index: | 46.030 | ||
| aromaticity | 0.069 | ||
| GRAVY | -0.067 | ||
Secondary Structure Fraction | |||
| Helix | 0.345 | ||
| turn | 0.259 | ||
| sheet | 0.224 | ||