| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142733.1 | internal | 166 | 3-500(+) |
Amino Acid sequence : | |||
| SNIQTLKQRAMRRDSNNMKPSTFLAISAHLWSCFVRAKSFGPEENSIVCILTDCRPRLDPPVEDGYFGNCVRLTNVNILVGDQTSEDRLSRACEEIGASIRRVSEDPLRDVEDWFDDLQN LPLERVTNVTASPRFKIYETDFGFGRPDRVELVSMNHDGEVTLAGG | |||
Physicochemical properties | |||
| Number of amino acids: | 166 | ||
| Molecular weight: | 18,736.831 | ||
| Theoretical pI: | 4.986 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
| Instability index: | 48.784 | ||
| aromaticity | 0.072 | ||
| GRAVY | -0.450 | ||
Secondary Structure Fraction | |||
| Helix | 0.283 | ||
| turn | 0.253 | ||
| sheet | 0.223 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142733.1 | internal | 166 | 3-500(+) |
Amino Acid sequence : | |||
| SNIQTLKQRAMRRDSNNMKPSTFLAISAHLWSCFVRAKSFGPEENSIVCILTDCRPRLDPPVEDGYFGNCVRLTNVNILVGDQTSEDRLSRACEEIGASIRRVSEDPLRDVEDWFDDLQN LPLERVTNVTASPRFKIYETDFGFGRPDRVELVSMNHDGEVTLAGG | |||
Physicochemical properties | |||
| Number of amino acids: | 166 | ||
| Molecular weight: | 18,736.831 | ||
| Theoretical pI: | 4.986 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
| Instability index: | 48.784 | ||
| aromaticity | 0.072 | ||
| GRAVY | -0.450 | ||
Secondary Structure Fraction | |||
| Helix | 0.283 | ||
| turn | 0.253 | ||
| sheet | 0.223 | ||