| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142739.1 | 5prime_partial | 171 | 3-518(+) |
Amino Acid sequence : | |||
| EYANNSVKGTIDRYKKACTDTSNSGTVSEANSQYYQQEASKLLQQIAQLQNSNRNLMGESLSTMSPRELRQLEGKLEKGINKIRAKKNELLYAEIEYMQKREMELQNDNMYLRNKISENE RAQQHMNMLPSATATEYEAMPPFDSRSFLQANLVDPNHHYSHQQQTALQLG* | |||
Physicochemical properties | |||
| Number of amino acids: | 171 | ||
| Molecular weight: | 11,634.751 | ||
| Theoretical pI: | 4.437 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 12085 | ||
| Instability index: | 57.887 | ||
| aromaticity | 0.162 | ||
| GRAVY | 1.096 | ||
Secondary Structure Fraction | |||
| Helix | 0.400 | ||
| turn | 0.286 | ||
| sheet | 0.295 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142739.1 | complete | 105 | 421-104(-) |
Amino Acid sequence : | |||
| MASYSVAVADGNMFMCCCALSFSDILFLRYILSFCSSISLFCMYSISAYNNSFFLALILLMPFSSFPSSCLSSLGLMVLSDSPIKFLFEFCNCAICCRSLEASCW* | |||
Physicochemical properties | |||
| Number of amino acids: | 105 | ||
| Molecular weight: | 11,634.751 | ||
| Theoretical pI: | 4.437 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 12085 | ||
| Instability index: | 57.887 | ||
| aromaticity | 0.162 | ||
| GRAVY | 1.096 | ||
Secondary Structure Fraction | |||
| Helix | 0.400 | ||
| turn | 0.286 | ||
| sheet | 0.295 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142739.1 | 5prime_partial | 171 | 3-518(+) |
Amino Acid sequence : | |||
| EYANNSVKGTIDRYKKACTDTSNSGTVSEANSQYYQQEASKLLQQIAQLQNSNRNLMGESLSTMSPRELRQLEGKLEKGINKIRAKKNELLYAEIEYMQKREMELQNDNMYLRNKISENE RAQQHMNMLPSATATEYEAMPPFDSRSFLQANLVDPNHHYSHQQQTALQLG* | |||
Physicochemical properties | |||
| Number of amino acids: | 171 | ||
| Molecular weight: | 11,634.751 | ||
| Theoretical pI: | 4.437 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 12085 | ||
| Instability index: | 57.887 | ||
| aromaticity | 0.162 | ||
| GRAVY | 1.096 | ||
Secondary Structure Fraction | |||
| Helix | 0.400 | ||
| turn | 0.286 | ||
| sheet | 0.295 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142739.1 | complete | 105 | 421-104(-) |
Amino Acid sequence : | |||
| MASYSVAVADGNMFMCCCALSFSDILFLRYILSFCSSISLFCMYSISAYNNSFFLALILLMPFSSFPSSCLSSLGLMVLSDSPIKFLFEFCNCAICCRSLEASCW* | |||
Physicochemical properties | |||
| Number of amino acids: | 105 | ||
| Molecular weight: | 11,634.751 | ||
| Theoretical pI: | 4.437 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 12085 | ||
| Instability index: | 57.887 | ||
| aromaticity | 0.162 | ||
| GRAVY | 1.096 | ||
Secondary Structure Fraction | |||
| Helix | 0.400 | ||
| turn | 0.286 | ||
| sheet | 0.295 | ||