Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX142743.1 | complete | 145 | 169-606(+) |
Amino Acid sequence : | |||
MVAIEKGVAAIAMDPIPSEARKVLHGLASMWCDVADSQALEVVPLKGAMTNEVFQIKWKTNDESPPRKVLVRIYGEGVDLFFDRENEIRTFESMSGHGHGPRLLGRFPNGRVEEFIHAKT LSAADLRDPEVSGSYRIKIEGLPCS* | |||
Physicochemical properties | |||
Number of amino acids: | 145 | ||
Molecular weight: | 16,049.233 | ||
Theoretical pI: | 5.813 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
Instability index: | 27.839 | ||
aromaticity | 0.069 | ||
GRAVY | -0.223 | ||
Secondary Structure Fraction | |||
Helix | 0.290 | ||
turn | 0.241 | ||
sheet | 0.283 |