| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142743.1 | complete | 145 | 169-606(+) |
Amino Acid sequence : | |||
| MVAIEKGVAAIAMDPIPSEARKVLHGLASMWCDVADSQALEVVPLKGAMTNEVFQIKWKTNDESPPRKVLVRIYGEGVDLFFDRENEIRTFESMSGHGHGPRLLGRFPNGRVEEFIHAKT LSAADLRDPEVSGSYRIKIEGLPCS* | |||
Physicochemical properties | |||
| Number of amino acids: | 145 | ||
| Molecular weight: | 16,049.233 | ||
| Theoretical pI: | 5.813 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14105 | ||
| Instability index: | 27.839 | ||
| aromaticity | 0.069 | ||
| GRAVY | -0.223 | ||
Secondary Structure Fraction | |||
| Helix | 0.290 | ||
| turn | 0.241 | ||
| sheet | 0.283 | ||