| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142770.1 | 5prime_partial | 169 | 2-511(+) |
Amino Acid sequence : | |||
| DLKAYDGSDPKKPLLMAIKAQIYDVTFSRMFYGPGGPYALFAGKDASRALAKMSFEDKDLTGDISGLGPFELEALQDWEYKFMSKYTKVGTIKKSVPETEGPTEAEVTEASTLTTERGLA EGQAEHSAESKEDNTPAKEEDTPTGDGDAEAKYVAELKEVVEEDKKTEE* | |||
Physicochemical properties | |||
| Number of amino acids: | 169 | ||
| Molecular weight: | 18,489.221 | ||
| Theoretical pI: | 4.506 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 15930 | ||
| Instability index: | 41.547 | ||
| aromaticity | 0.083 | ||
| GRAVY | -0.760 | ||
Secondary Structure Fraction | |||
| Helix | 0.219 | ||
| turn | 0.201 | ||
| sheet | 0.337 | ||