| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142773.1 | internal | 150 | 2-451(+) |
Amino Acid sequence : | |||
| DNPGLPCFLFGHSTGGAIVLKAVLDPKIEARIEGVVLTSPAIRVQPSHPIVEILAPICSLLVPKYQFSSANNKGPPVSRDPEALKAKYSDPLVFTGAIRIRTGYEILRTSYYLQRNLNRV TVPFLVLHGTSDTVTDPEATQRLYQEASST | |||
Physicochemical properties | |||
| Number of amino acids: | 150 | ||
| Molecular weight: | 16,373.616 | ||
| Theoretical pI: | 8.623 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 9065 | ||
| Instability index: | 39.077 | ||
| aromaticity | 0.073 | ||
| GRAVY | -0.039 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.267 | ||
| sheet | 0.227 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142773.1 | internal | 150 | 2-451(+) |
Amino Acid sequence : | |||
| DNPGLPCFLFGHSTGGAIVLKAVLDPKIEARIEGVVLTSPAIRVQPSHPIVEILAPICSLLVPKYQFSSANNKGPPVSRDPEALKAKYSDPLVFTGAIRIRTGYEILRTSYYLQRNLNRV TVPFLVLHGTSDTVTDPEATQRLYQEASST | |||
Physicochemical properties | |||
| Number of amino acids: | 150 | ||
| Molecular weight: | 16,373.616 | ||
| Theoretical pI: | 8.623 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 9065 | ||
| Instability index: | 39.077 | ||
| aromaticity | 0.073 | ||
| GRAVY | -0.039 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.267 | ||
| sheet | 0.227 | ||