| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142786.1 | internal | 132 | 397-2(-) |
Amino Acid sequence : | |||
| STLNLVDLLNFRPSTATAGRSGTILVHAGAHISTGTLIHLRNNGVADSLKLLHLVIKLVRLRQLVRLEPQDGLLNHVLNLLLVLGRQLQCNLVVSNGVPHVVRVVLQSILGLHLLLVLLV LRLVLLRLLHHL | |||
Physicochemical properties | |||
| Number of amino acids: | 132 | ||
| Molecular weight: | 14,136.664 | ||
| Theoretical pI: | 4.535 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
| Instability index: | 50.342 | ||
| aromaticity | 0.047 | ||
| GRAVY | -0.881 | ||
Secondary Structure Fraction | |||
| Helix | 0.205 | ||
| turn | 0.197 | ||
| sheet | 0.362 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142786.1 | 5prime_partial | 127 | 2-385(+) |
Amino Acid sequence : | |||
| KMVQEAEKYKSEDEEHKKKVESKNALENYSYNMRNTIRDDKIALKLPAEDKKKIEDVIEEAILWLEANQLAEADEFDDKMKELEGICNPIIAKMYQGAGADMGAGMDEDGPAPTGGSSAG PKIEEVD* | |||
Physicochemical properties | |||
| Number of amino acids: | 127 | ||
| Molecular weight: | 14,136.664 | ||
| Theoretical pI: | 4.535 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
| Instability index: | 50.342 | ||
| aromaticity | 0.047 | ||
| GRAVY | -0.881 | ||
Secondary Structure Fraction | |||
| Helix | 0.205 | ||
| turn | 0.197 | ||
| sheet | 0.362 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142786.1 | internal | 132 | 397-2(-) |
Amino Acid sequence : | |||
| STLNLVDLLNFRPSTATAGRSGTILVHAGAHISTGTLIHLRNNGVADSLKLLHLVIKLVRLRQLVRLEPQDGLLNHVLNLLLVLGRQLQCNLVVSNGVPHVVRVVLQSILGLHLLLVLLV LRLVLLRLLHHL | |||
Physicochemical properties | |||
| Number of amino acids: | 132 | ||
| Molecular weight: | 14,136.664 | ||
| Theoretical pI: | 4.535 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
| Instability index: | 50.342 | ||
| aromaticity | 0.047 | ||
| GRAVY | -0.881 | ||
Secondary Structure Fraction | |||
| Helix | 0.205 | ||
| turn | 0.197 | ||
| sheet | 0.362 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142786.1 | 5prime_partial | 127 | 2-385(+) |
Amino Acid sequence : | |||
| KMVQEAEKYKSEDEEHKKKVESKNALENYSYNMRNTIRDDKIALKLPAEDKKKIEDVIEEAILWLEANQLAEADEFDDKMKELEGICNPIIAKMYQGAGADMGAGMDEDGPAPTGGSSAG PKIEEVD* | |||
Physicochemical properties | |||
| Number of amino acids: | 127 | ||
| Molecular weight: | 14,136.664 | ||
| Theoretical pI: | 4.535 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11460 | ||
| Instability index: | 50.342 | ||
| aromaticity | 0.047 | ||
| GRAVY | -0.881 | ||
Secondary Structure Fraction | |||
| Helix | 0.205 | ||
| turn | 0.197 | ||
| sheet | 0.362 | ||