| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142788.1 | internal | 154 | 3-464(+) |
Amino Acid sequence : | |||
| DMEIVTTEQEESSLKVPEGSNGVFLKNLYLSCDPYMRSRMSKHDEASYVPDFVPGSVISGFGVGKVLDSKHPDFKVGDFVWGMTGWEEYSLITSPNQANLIKIKYTDVPLSYYTGILGMP GFTAYVGFYEIGSPKKGEYVFISAASGAVGQLVG | |||
Physicochemical properties | |||
| Number of amino acids: | 154 | ||
| Molecular weight: | 16,831.884 | ||
| Theoretical pI: | 4.829 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25900 25900 | ||
| Instability index: | 36.927 | ||
| aromaticity | 0.130 | ||
| GRAVY | -0.090 | ||
Secondary Structure Fraction | |||
| Helix | 0.344 | ||
| turn | 0.305 | ||
| sheet | 0.201 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142788.1 | internal | 154 | 3-464(+) |
Amino Acid sequence : | |||
| DMEIVTTEQEESSLKVPEGSNGVFLKNLYLSCDPYMRSRMSKHDEASYVPDFVPGSVISGFGVGKVLDSKHPDFKVGDFVWGMTGWEEYSLITSPNQANLIKIKYTDVPLSYYTGILGMP GFTAYVGFYEIGSPKKGEYVFISAASGAVGQLVG | |||
Physicochemical properties | |||
| Number of amino acids: | 154 | ||
| Molecular weight: | 16,831.884 | ||
| Theoretical pI: | 4.829 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 25900 25900 | ||
| Instability index: | 36.927 | ||
| aromaticity | 0.130 | ||
| GRAVY | -0.090 | ||
Secondary Structure Fraction | |||
| Helix | 0.344 | ||
| turn | 0.305 | ||
| sheet | 0.201 | ||