| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142791.1 | internal | 120 | 3-362(+) |
Amino Acid sequence : | |||
| EYRYYDPRTVALDFDGMIADIKAAPDGSFILLHGCAHNPTGIDPTPDQWEKIADVIQEKNHVPFFDVAYQGFASGSLDEDASSVRLFVARGMELLVAQSYSKNLGLYAERIGAINVVCSS | |||
Physicochemical properties | |||
| Number of amino acids: | 120 | ||
| Molecular weight: | 13,172.624 | ||
| Theoretical pI: | 4.584 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14565 | ||
| Instability index: | 23.401 | ||
| aromaticity | 0.108 | ||
| GRAVY | -0.078 | ||
Secondary Structure Fraction | |||
| Helix | 0.325 | ||
| turn | 0.233 | ||
| sheet | 0.250 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142791.1 | internal | 120 | 3-362(+) |
Amino Acid sequence : | |||
| EYRYYDPRTVALDFDGMIADIKAAPDGSFILLHGCAHNPTGIDPTPDQWEKIADVIQEKNHVPFFDVAYQGFASGSLDEDASSVRLFVARGMELLVAQSYSKNLGLYAERIGAINVVCSS | |||
Physicochemical properties | |||
| Number of amino acids: | 120 | ||
| Molecular weight: | 13,172.624 | ||
| Theoretical pI: | 4.584 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14565 | ||
| Instability index: | 23.401 | ||
| aromaticity | 0.108 | ||
| GRAVY | -0.078 | ||
Secondary Structure Fraction | |||
| Helix | 0.325 | ||
| turn | 0.233 | ||
| sheet | 0.250 | ||