Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX142799.1 | internal | 113 | 3-341(+) |
Amino Acid sequence : | |||
PYYEEHRRLTALHSEIEELLYNPIDNSEHKGFLKDRIKPIIFSMARLDRVKNITGLVELYGRNPRLKELVNLVVVAGDHVKESKDHEEIEEKKKMYRLINEYELEGHIRWISA | |||
Physicochemical properties | |||
Number of amino acids: | 113 | ||
Molecular weight: | 13,468.276 | ||
Theoretical pI: | 6.352 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14440 | ||
Instability index: | 53.656 | ||
aromaticity | 0.080 | ||
GRAVY | -0.666 | ||
Secondary Structure Fraction | |||
Helix | 0.345 | ||
turn | 0.177 | ||
sheet | 0.310 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX142799.1 | internal | 113 | 3-341(+) |
Amino Acid sequence : | |||
PYYEEHRRLTALHSEIEELLYNPIDNSEHKGFLKDRIKPIIFSMARLDRVKNITGLVELYGRNPRLKELVNLVVVAGDHVKESKDHEEIEEKKKMYRLINEYELEGHIRWISA | |||
Physicochemical properties | |||
Number of amino acids: | 113 | ||
Molecular weight: | 13,468.276 | ||
Theoretical pI: | 6.352 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14440 | ||
Instability index: | 53.656 | ||
aromaticity | 0.080 | ||
GRAVY | -0.666 | ||
Secondary Structure Fraction | |||
Helix | 0.345 | ||
turn | 0.177 | ||
sheet | 0.310 |