| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142799.1 | internal | 113 | 3-341(+) |
Amino Acid sequence : | |||
| PYYEEHRRLTALHSEIEELLYNPIDNSEHKGFLKDRIKPIIFSMARLDRVKNITGLVELYGRNPRLKELVNLVVVAGDHVKESKDHEEIEEKKKMYRLINEYELEGHIRWISA | |||
Physicochemical properties | |||
| Number of amino acids: | 113 | ||
| Molecular weight: | 13,468.276 | ||
| Theoretical pI: | 6.352 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14440 | ||
| Instability index: | 53.656 | ||
| aromaticity | 0.080 | ||
| GRAVY | -0.666 | ||
Secondary Structure Fraction | |||
| Helix | 0.345 | ||
| turn | 0.177 | ||
| sheet | 0.310 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142799.1 | internal | 113 | 3-341(+) |
Amino Acid sequence : | |||
| PYYEEHRRLTALHSEIEELLYNPIDNSEHKGFLKDRIKPIIFSMARLDRVKNITGLVELYGRNPRLKELVNLVVVAGDHVKESKDHEEIEEKKKMYRLINEYELEGHIRWISA | |||
Physicochemical properties | |||
| Number of amino acids: | 113 | ||
| Molecular weight: | 13,468.276 | ||
| Theoretical pI: | 6.352 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14440 | ||
| Instability index: | 53.656 | ||
| aromaticity | 0.080 | ||
| GRAVY | -0.666 | ||
Secondary Structure Fraction | |||
| Helix | 0.345 | ||
| turn | 0.177 | ||
| sheet | 0.310 | ||