| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142801.1 | 5prime_partial | 153 | 2-463(+) |
Amino Acid sequence : | |||
| RVLPLSEQITFLISLARRRFLKWKKIKPYVPDFKLAFEHMCIHAGGRAVLDEMERSLGLGEWHMEPSRMTLYRFGNTSTSSLWYELAYCEAQGRIRRGDRLWQIAFGAGFKCNSAVWRAL RTVDARHQNHKINPWTDEIHEFPVCVPKVANVI* | |||
Physicochemical properties | |||
| Number of amino acids: | 153 | ||
| Molecular weight: | 15,283.271 | ||
| Theoretical pI: | 5.924 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6085 | ||
| Instability index: | 45.772 | ||
| aromaticity | 0.058 | ||
| GRAVY | -0.140 | ||
Secondary Structure Fraction | |||
| Helix | 0.319 | ||
| turn | 0.254 | ||
| sheet | 0.254 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142801.1 | 5prime_partial | 138 | 478-62(-) |
Amino Acid sequence : | |||
| SHDTYLYDICNLGHTNRKFMDLISPRVNLVILVTSIDSPESTPDRAVTLESGSECYLPQAIASSDPPLGFAICELVPQRARGSVPESVQRHPRRLHVPLPEAQAPLHLVQHGPATRVDAH VLERELKIGDVGLYFLPF* | |||
Physicochemical properties | |||
| Number of amino acids: | 138 | ||
| Molecular weight: | 15,283.271 | ||
| Theoretical pI: | 5.924 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6085 | ||
| Instability index: | 45.772 | ||
| aromaticity | 0.058 | ||
| GRAVY | -0.140 | ||
Secondary Structure Fraction | |||
| Helix | 0.319 | ||
| turn | 0.254 | ||
| sheet | 0.254 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142801.1 | 5prime_partial | 153 | 2-463(+) |
Amino Acid sequence : | |||
| RVLPLSEQITFLISLARRRFLKWKKIKPYVPDFKLAFEHMCIHAGGRAVLDEMERSLGLGEWHMEPSRMTLYRFGNTSTSSLWYELAYCEAQGRIRRGDRLWQIAFGAGFKCNSAVWRAL RTVDARHQNHKINPWTDEIHEFPVCVPKVANVI* | |||
Physicochemical properties | |||
| Number of amino acids: | 153 | ||
| Molecular weight: | 15,283.271 | ||
| Theoretical pI: | 5.924 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6085 | ||
| Instability index: | 45.772 | ||
| aromaticity | 0.058 | ||
| GRAVY | -0.140 | ||
Secondary Structure Fraction | |||
| Helix | 0.319 | ||
| turn | 0.254 | ||
| sheet | 0.254 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142801.1 | 5prime_partial | 138 | 478-62(-) |
Amino Acid sequence : | |||
| SHDTYLYDICNLGHTNRKFMDLISPRVNLVILVTSIDSPESTPDRAVTLESGSECYLPQAIASSDPPLGFAICELVPQRARGSVPESVQRHPRRLHVPLPEAQAPLHLVQHGPATRVDAH VLERELKIGDVGLYFLPF* | |||
Physicochemical properties | |||
| Number of amino acids: | 138 | ||
| Molecular weight: | 15,283.271 | ||
| Theoretical pI: | 5.924 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6085 | ||
| Instability index: | 45.772 | ||
| aromaticity | 0.058 | ||
| GRAVY | -0.140 | ||
Secondary Structure Fraction | |||
| Helix | 0.319 | ||
| turn | 0.254 | ||
| sheet | 0.254 | ||