Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX142801.1 | 5prime_partial | 153 | 2-463(+) |
Amino Acid sequence : | |||
RVLPLSEQITFLISLARRRFLKWKKIKPYVPDFKLAFEHMCIHAGGRAVLDEMERSLGLGEWHMEPSRMTLYRFGNTSTSSLWYELAYCEAQGRIRRGDRLWQIAFGAGFKCNSAVWRAL RTVDARHQNHKINPWTDEIHEFPVCVPKVANVI* | |||
Physicochemical properties | |||
Number of amino acids: | 153 | ||
Molecular weight: | 15,283.271 | ||
Theoretical pI: | 5.924 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6085 | ||
Instability index: | 45.772 | ||
aromaticity | 0.058 | ||
GRAVY | -0.140 | ||
Secondary Structure Fraction | |||
Helix | 0.319 | ||
turn | 0.254 | ||
sheet | 0.254 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX142801.1 | 5prime_partial | 138 | 478-62(-) |
Amino Acid sequence : | |||
SHDTYLYDICNLGHTNRKFMDLISPRVNLVILVTSIDSPESTPDRAVTLESGSECYLPQAIASSDPPLGFAICELVPQRARGSVPESVQRHPRRLHVPLPEAQAPLHLVQHGPATRVDAH VLERELKIGDVGLYFLPF* | |||
Physicochemical properties | |||
Number of amino acids: | 138 | ||
Molecular weight: | 15,283.271 | ||
Theoretical pI: | 5.924 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6085 | ||
Instability index: | 45.772 | ||
aromaticity | 0.058 | ||
GRAVY | -0.140 | ||
Secondary Structure Fraction | |||
Helix | 0.319 | ||
turn | 0.254 | ||
sheet | 0.254 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX142801.1 | 5prime_partial | 153 | 2-463(+) |
Amino Acid sequence : | |||
RVLPLSEQITFLISLARRRFLKWKKIKPYVPDFKLAFEHMCIHAGGRAVLDEMERSLGLGEWHMEPSRMTLYRFGNTSTSSLWYELAYCEAQGRIRRGDRLWQIAFGAGFKCNSAVWRAL RTVDARHQNHKINPWTDEIHEFPVCVPKVANVI* | |||
Physicochemical properties | |||
Number of amino acids: | 153 | ||
Molecular weight: | 15,283.271 | ||
Theoretical pI: | 5.924 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6085 | ||
Instability index: | 45.772 | ||
aromaticity | 0.058 | ||
GRAVY | -0.140 | ||
Secondary Structure Fraction | |||
Helix | 0.319 | ||
turn | 0.254 | ||
sheet | 0.254 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX142801.1 | 5prime_partial | 138 | 478-62(-) |
Amino Acid sequence : | |||
SHDTYLYDICNLGHTNRKFMDLISPRVNLVILVTSIDSPESTPDRAVTLESGSECYLPQAIASSDPPLGFAICELVPQRARGSVPESVQRHPRRLHVPLPEAQAPLHLVQHGPATRVDAH VLERELKIGDVGLYFLPF* | |||
Physicochemical properties | |||
Number of amino acids: | 138 | ||
Molecular weight: | 15,283.271 | ||
Theoretical pI: | 5.924 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6085 | ||
Instability index: | 45.772 | ||
aromaticity | 0.058 | ||
GRAVY | -0.140 | ||
Secondary Structure Fraction | |||
Helix | 0.319 | ||
turn | 0.254 | ||
sheet | 0.254 |