Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX142819.1 | internal | 154 | 2-463(+) |
Amino Acid sequence : | |||
FGTRGYSGRLYSAPECSFRAPAMAEKFNMKNPSVKRILQEVKEMQSNPSDDFMSLPLEENIFEWQFAIRGPRDTEFEGGIYHGRIQLPNDYPFKPPSFMLLTPNGRFETQTKICLSISNY HPEHWQPSWSVRTALVALIAFMPTNPGGALGSLD | |||
Physicochemical properties | |||
Number of amino acids: | 154 | ||
Molecular weight: | 17,491.696 | ||
Theoretical pI: | 6.351 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24075 | ||
Instability index: | 43.479 | ||
aromaticity | 0.123 | ||
GRAVY | -0.452 | ||
Secondary Structure Fraction | |||
Helix | 0.279 | ||
turn | 0.305 | ||
sheet | 0.247 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX142819.1 | internal | 154 | 2-463(+) |
Amino Acid sequence : | |||
FGTRGYSGRLYSAPECSFRAPAMAEKFNMKNPSVKRILQEVKEMQSNPSDDFMSLPLEENIFEWQFAIRGPRDTEFEGGIYHGRIQLPNDYPFKPPSFMLLTPNGRFETQTKICLSISNY HPEHWQPSWSVRTALVALIAFMPTNPGGALGSLD | |||
Physicochemical properties | |||
Number of amino acids: | 154 | ||
Molecular weight: | 17,491.696 | ||
Theoretical pI: | 6.351 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24075 | ||
Instability index: | 43.479 | ||
aromaticity | 0.123 | ||
GRAVY | -0.452 | ||
Secondary Structure Fraction | |||
Helix | 0.279 | ||
turn | 0.305 | ||
sheet | 0.247 |