| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142819.1 | internal | 154 | 2-463(+) |
Amino Acid sequence : | |||
| FGTRGYSGRLYSAPECSFRAPAMAEKFNMKNPSVKRILQEVKEMQSNPSDDFMSLPLEENIFEWQFAIRGPRDTEFEGGIYHGRIQLPNDYPFKPPSFMLLTPNGRFETQTKICLSISNY HPEHWQPSWSVRTALVALIAFMPTNPGGALGSLD | |||
Physicochemical properties | |||
| Number of amino acids: | 154 | ||
| Molecular weight: | 17,491.696 | ||
| Theoretical pI: | 6.351 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24075 | ||
| Instability index: | 43.479 | ||
| aromaticity | 0.123 | ||
| GRAVY | -0.452 | ||
Secondary Structure Fraction | |||
| Helix | 0.279 | ||
| turn | 0.305 | ||
| sheet | 0.247 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142819.1 | internal | 154 | 2-463(+) |
Amino Acid sequence : | |||
| FGTRGYSGRLYSAPECSFRAPAMAEKFNMKNPSVKRILQEVKEMQSNPSDDFMSLPLEENIFEWQFAIRGPRDTEFEGGIYHGRIQLPNDYPFKPPSFMLLTPNGRFETQTKICLSISNY HPEHWQPSWSVRTALVALIAFMPTNPGGALGSLD | |||
Physicochemical properties | |||
| Number of amino acids: | 154 | ||
| Molecular weight: | 17,491.696 | ||
| Theoretical pI: | 6.351 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 23950 24075 | ||
| Instability index: | 43.479 | ||
| aromaticity | 0.123 | ||
| GRAVY | -0.452 | ||
Secondary Structure Fraction | |||
| Helix | 0.279 | ||
| turn | 0.305 | ||
| sheet | 0.247 | ||