| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142825.1 | 3prime_partial | 143 | 36-464(+) |
Amino Acid sequence : | |||
| MESIPVIARKLEGKVAVITGGASGIGECTARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVDKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVN LIGPFLGTKHAARVMIPARCRGS | |||
Physicochemical properties | |||
| Number of amino acids: | 143 | ||
| Molecular weight: | 15,145.249 | ||
| Theoretical pI: | 6.407 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
| Instability index: | 25.074 | ||
| aromaticity | 0.049 | ||
| GRAVY | 0.116 | ||
Secondary Structure Fraction | |||
| Helix | 0.301 | ||
| turn | 0.238 | ||
| sheet | 0.245 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142825.1 | 3prime_partial | 143 | 36-464(+) |
Amino Acid sequence : | |||
| MESIPVIARKLEGKVAVITGGASGIGECTARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVDKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVN LIGPFLGTKHAARVMIPARCRGS | |||
Physicochemical properties | |||
| Number of amino acids: | 143 | ||
| Molecular weight: | 15,145.249 | ||
| Theoretical pI: | 6.407 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3230 | ||
| Instability index: | 25.074 | ||
| aromaticity | 0.049 | ||
| GRAVY | 0.116 | ||
Secondary Structure Fraction | |||
| Helix | 0.301 | ||
| turn | 0.238 | ||
| sheet | 0.245 | ||