| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142829.1 | internal | 148 | 3-446(+) |
Amino Acid sequence : | |||
| KLALNLDHLILYTPEQTDLSNARSTQKQFNTWFEGVMADYELTEDKMQIILNGLMVWCIENGTSPNINGMWVMMDGDDQVEFPIKPLIDHAKPTFRQIMAHFSDVAEAYIEKRNQDRPYM PRYGLQRNLTDMSLARYAFDFYEMTSRT | |||
Physicochemical properties | |||
| Number of amino acids: | 148 | ||
| Molecular weight: | 17,369.586 | ||
| Theoretical pI: | 4.855 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 26930 | ||
| Instability index: | 46.862 | ||
| aromaticity | 0.115 | ||
| GRAVY | -0.480 | ||
Secondary Structure Fraction | |||
| Helix | 0.297 | ||
| turn | 0.189 | ||
| sheet | 0.277 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142829.1 | internal | 148 | 3-446(+) |
Amino Acid sequence : | |||
| KLALNLDHLILYTPEQTDLSNARSTQKQFNTWFEGVMADYELTEDKMQIILNGLMVWCIENGTSPNINGMWVMMDGDDQVEFPIKPLIDHAKPTFRQIMAHFSDVAEAYIEKRNQDRPYM PRYGLQRNLTDMSLARYAFDFYEMTSRT | |||
Physicochemical properties | |||
| Number of amino acids: | 148 | ||
| Molecular weight: | 17,369.586 | ||
| Theoretical pI: | 4.855 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 26930 | ||
| Instability index: | 46.862 | ||
| aromaticity | 0.115 | ||
| GRAVY | -0.480 | ||
Secondary Structure Fraction | |||
| Helix | 0.297 | ||
| turn | 0.189 | ||
| sheet | 0.277 | ||