| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142831.1 | internal | 169 | 2-508(+) |
Amino Acid sequence : | |||
| HEKDFVKRLLNKDYRKRMTASQALSHPWIQDFQEVKIPLDIMIYKLVKAYICSSSLRKSALRALAKTLTVPQLSYLREQFSLLGPTKTGYISMQNFKTALMKCSTEAMKDSKVLDFINVV CSLQYRKLDFEEFAAASISVHQLEGLDTWEQHARRGYELFEKDGNRPIM | |||
Physicochemical properties | |||
| Number of amino acids: | 169 | ||
| Molecular weight: | 19,630.613 | ||
| Theoretical pI: | 9.319 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21555 | ||
| Instability index: | 24.700 | ||
| aromaticity | 0.101 | ||
| GRAVY | -0.337 | ||
Secondary Structure Fraction | |||
| Helix | 0.320 | ||
| turn | 0.166 | ||
| sheet | 0.284 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142831.1 | internal | 169 | 2-508(+) |
Amino Acid sequence : | |||
| HEKDFVKRLLNKDYRKRMTASQALSHPWIQDFQEVKIPLDIMIYKLVKAYICSSSLRKSALRALAKTLTVPQLSYLREQFSLLGPTKTGYISMQNFKTALMKCSTEAMKDSKVLDFINVV CSLQYRKLDFEEFAAASISVHQLEGLDTWEQHARRGYELFEKDGNRPIM | |||
Physicochemical properties | |||
| Number of amino acids: | 169 | ||
| Molecular weight: | 19,630.613 | ||
| Theoretical pI: | 9.319 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 21430 21555 | ||
| Instability index: | 24.700 | ||
| aromaticity | 0.101 | ||
| GRAVY | -0.337 | ||
Secondary Structure Fraction | |||
| Helix | 0.320 | ||
| turn | 0.166 | ||
| sheet | 0.284 | ||