| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142843.1 | 5prime_partial | 172 | 2-520(+) |
Amino Acid sequence : | |||
| HEEELKAYDGSDPKKPLLMAIKAQIYDVTQSRMFYGPGGPYALFAGKDASRALAKMSFEDKDLTGDISGLGPFELEALQDWEYKFMSKYTKVGTIKKSVPETEGPTEAEVTEASTLTTER GLAEGQAEHSAESKEDNTPAKEEDTPTGDGDAEAKYVAELKEVVEEDKKTEE* | |||
Physicochemical properties | |||
| Number of amino acids: | 172 | ||
| Molecular weight: | 18,879.571 | ||
| Theoretical pI: | 4.511 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 15930 | ||
| Instability index: | 46.187 | ||
| aromaticity | 0.076 | ||
| GRAVY | -0.842 | ||
Secondary Structure Fraction | |||
| Helix | 0.209 | ||
| turn | 0.198 | ||
| sheet | 0.349 | ||