Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX142843.1 | 5prime_partial | 172 | 2-520(+) |
Amino Acid sequence : | |||
HEEELKAYDGSDPKKPLLMAIKAQIYDVTQSRMFYGPGGPYALFAGKDASRALAKMSFEDKDLTGDISGLGPFELEALQDWEYKFMSKYTKVGTIKKSVPETEGPTEAEVTEASTLTTER GLAEGQAEHSAESKEDNTPAKEEDTPTGDGDAEAKYVAELKEVVEEDKKTEE* | |||
Physicochemical properties | |||
Number of amino acids: | 172 | ||
Molecular weight: | 18,879.571 | ||
Theoretical pI: | 4.511 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 15930 | ||
Instability index: | 46.187 | ||
aromaticity | 0.076 | ||
GRAVY | -0.842 | ||
Secondary Structure Fraction | |||
Helix | 0.209 | ||
turn | 0.198 | ||
sheet | 0.349 |