| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142846.1 | internal | 235 | 3-707(+) |
Amino Acid sequence : | |||
| TSYCCGEDLLTKCAQGKTSLERFTSVVAWSISTARPVVFGLAPYNPILGETHHVSKETLNVLLEQVSHHPPVSALHATDTKENIELIWCQNPVPKFHGASIEAVIHGKRELRLKIFGEKY EMDSPNLLIRILPLPAADWVGDVTIQCKKSGLKADLSFYKIKSFLGIGGNSTSVKGKIFHSDTLKTIYEMEGQWDRTITLKDVHTGDVTVLYDALEAISKLSTPVVKHPKGVRPT | |||
Physicochemical properties | |||
| Number of amino acids: | 235 | ||
| Molecular weight: | 12,414.285 | ||
| Theoretical pI: | 9.657 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21095 | ||
| Instability index: | 43.339 | ||
| aromaticity | 0.104 | ||
| GRAVY | -0.450 | ||
Secondary Structure Fraction | |||
| Helix | 0.292 | ||
| turn | 0.264 | ||
| sheet | 0.236 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142846.1 | 3prime_partial | 106 | 320-3(-) |
Amino Acid sequence : | |||
| MNHSFNASPMELGYWVLTPDQFYILLCISCMESRYWWVMRDLLKEDIEGFFRHMMGFSKDRIIRSQTKNNRPRGRNAPCNNRSEPLKAGLPLSTLGQKVLSTTITR | |||
Physicochemical properties | |||
| Number of amino acids: | 106 | ||
| Molecular weight: | 12,414.285 | ||
| Theoretical pI: | 9.657 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21095 | ||
| Instability index: | 43.339 | ||
| aromaticity | 0.104 | ||
| GRAVY | -0.450 | ||
Secondary Structure Fraction | |||
| Helix | 0.292 | ||
| turn | 0.264 | ||
| sheet | 0.236 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142846.1 | internal | 235 | 3-707(+) |
Amino Acid sequence : | |||
| TSYCCGEDLLTKCAQGKTSLERFTSVVAWSISTARPVVFGLAPYNPILGETHHVSKETLNVLLEQVSHHPPVSALHATDTKENIELIWCQNPVPKFHGASIEAVIHGKRELRLKIFGEKY EMDSPNLLIRILPLPAADWVGDVTIQCKKSGLKADLSFYKIKSFLGIGGNSTSVKGKIFHSDTLKTIYEMEGQWDRTITLKDVHTGDVTVLYDALEAISKLSTPVVKHPKGVRPT | |||
Physicochemical properties | |||
| Number of amino acids: | 235 | ||
| Molecular weight: | 12,414.285 | ||
| Theoretical pI: | 9.657 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21095 | ||
| Instability index: | 43.339 | ||
| aromaticity | 0.104 | ||
| GRAVY | -0.450 | ||
Secondary Structure Fraction | |||
| Helix | 0.292 | ||
| turn | 0.264 | ||
| sheet | 0.236 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142846.1 | 3prime_partial | 106 | 320-3(-) |
Amino Acid sequence : | |||
| MNHSFNASPMELGYWVLTPDQFYILLCISCMESRYWWVMRDLLKEDIEGFFRHMMGFSKDRIIRSQTKNNRPRGRNAPCNNRSEPLKAGLPLSTLGQKVLSTTITR | |||
Physicochemical properties | |||
| Number of amino acids: | 106 | ||
| Molecular weight: | 12,414.285 | ||
| Theoretical pI: | 9.657 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21095 | ||
| Instability index: | 43.339 | ||
| aromaticity | 0.104 | ||
| GRAVY | -0.450 | ||
Secondary Structure Fraction | |||
| Helix | 0.292 | ||
| turn | 0.264 | ||
| sheet | 0.236 | ||