| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142851.1 | 5prime_partial | 118 | 1-357(+) |
Amino Acid sequence : | |||
| KVDDERRVKVAVVTQGGMLDLGFLSFLNIFEIIERTDDSCTIRSSLEYEVDDEHADAAKLASTASLAMIAKAIVKHLLENEKEGCMKVMSSKLCFDYKLWFKRLFQSKARGVKISDAM* | |||
Physicochemical properties | |||
| Number of amino acids: | 118 | ||
| Molecular weight: | 13,310.323 | ||
| Theoretical pI: | 6.158 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 40.681 | ||
| aromaticity | 0.076 | ||
| GRAVY | -0.072 | ||
Secondary Structure Fraction | |||
| Helix | 0.314 | ||
| turn | 0.144 | ||
| sheet | 0.314 | ||