Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX142851.1 | 5prime_partial | 118 | 1-357(+) |
Amino Acid sequence : | |||
KVDDERRVKVAVVTQGGMLDLGFLSFLNIFEIIERTDDSCTIRSSLEYEVDDEHADAAKLASTASLAMIAKAIVKHLLENEKEGCMKVMSSKLCFDYKLWFKRLFQSKARGVKISDAM* | |||
Physicochemical properties | |||
Number of amino acids: | 118 | ||
Molecular weight: | 13,310.323 | ||
Theoretical pI: | 6.158 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
Instability index: | 40.681 | ||
aromaticity | 0.076 | ||
GRAVY | -0.072 | ||
Secondary Structure Fraction | |||
Helix | 0.314 | ||
turn | 0.144 | ||
sheet | 0.314 |