Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX142865.1 | complete | 129 | 2-391(+) |
Amino Acid sequence : | |||
MTCGLPMFATAYGGPAEIIVDGVSGYHIDPYQGDKAAELLVDFFDKCKDDPTHWDKFSEQGLKRIEEKYTWKLYSERLMTLAGVYGFWKFVSKLDRRETRRYLEMFYALKYRNLANSVPL AVDGEDDAK* | |||
Physicochemical properties | |||
Number of amino acids: | 129 | ||
Molecular weight: | 14,924.819 | ||
Theoretical pI: | 5.398 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29910 30035 | ||
Instability index: | 32.757 | ||
aromaticity | 0.147 | ||
GRAVY | -0.463 | ||
Secondary Structure Fraction | |||
Helix | 0.326 | ||
turn | 0.171 | ||
sheet | 0.271 |