| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142865.1 | complete | 129 | 2-391(+) |
Amino Acid sequence : | |||
| MTCGLPMFATAYGGPAEIIVDGVSGYHIDPYQGDKAAELLVDFFDKCKDDPTHWDKFSEQGLKRIEEKYTWKLYSERLMTLAGVYGFWKFVSKLDRRETRRYLEMFYALKYRNLANSVPL AVDGEDDAK* | |||
Physicochemical properties | |||
| Number of amino acids: | 129 | ||
| Molecular weight: | 14,924.819 | ||
| Theoretical pI: | 5.398 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 29910 30035 | ||
| Instability index: | 32.757 | ||
| aromaticity | 0.147 | ||
| GRAVY | -0.463 | ||
Secondary Structure Fraction | |||
| Helix | 0.326 | ||
| turn | 0.171 | ||
| sheet | 0.271 | ||