Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX142875.1 | 3prime_partial | 177 | 110-640(+) |
Amino Acid sequence : | |||
MDSSKSKEQLHKETDDPKAGKIQGVISQMIMPHLLNLYGACATARDFEIYAPDATFEDPLMCANGVKQIKSAFYSLGKIFSESRIAEYSIQENAIAPGKAEILIDNKQHYKIFGKEVDMI SLIKLQTVDGKIVRHEDWWDKKPLKNRDTTSVPLIGRLAEMARRGSMLATHAMMGFG | |||
Physicochemical properties | |||
Number of amino acids: | 177 | ||
Molecular weight: | 19,833.719 | ||
Theoretical pI: | 7.762 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18575 | ||
Instability index: | 37.254 | ||
aromaticity | 0.073 | ||
GRAVY | -0.344 | ||
Secondary Structure Fraction | |||
Helix | 0.271 | ||
turn | 0.203 | ||
sheet | 0.277 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX142875.1 | 3prime_partial | 177 | 110-640(+) |
Amino Acid sequence : | |||
MDSSKSKEQLHKETDDPKAGKIQGVISQMIMPHLLNLYGACATARDFEIYAPDATFEDPLMCANGVKQIKSAFYSLGKIFSESRIAEYSIQENAIAPGKAEILIDNKQHYKIFGKEVDMI SLIKLQTVDGKIVRHEDWWDKKPLKNRDTTSVPLIGRLAEMARRGSMLATHAMMGFG | |||
Physicochemical properties | |||
Number of amino acids: | 177 | ||
Molecular weight: | 19,833.719 | ||
Theoretical pI: | 7.762 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18575 | ||
Instability index: | 37.254 | ||
aromaticity | 0.073 | ||
GRAVY | -0.344 | ||
Secondary Structure Fraction | |||
Helix | 0.271 | ||
turn | 0.203 | ||
sheet | 0.277 |