| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142886.1 | internal | 203 | 1-609(+) |
Amino Acid sequence : | |||
| ESIPVIARKLEGKVAVITGGASGIGECTARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVNKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVNL IGPFLGTKHAARVMIPARCRGSIISMSSIASVNAGITPHGYACSKHGVVGLTKCAAFELGTHGIRVNCVSPQLLSTPLTTGFY | |||
Physicochemical properties | |||
| Number of amino acids: | 203 | ||
| Molecular weight: | 21,273.274 | ||
| Theoretical pI: | 8.230 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6335 | ||
| Instability index: | 29.552 | ||
| aromaticity | 0.054 | ||
| GRAVY | 0.223 | ||
Secondary Structure Fraction | |||
| Helix | 0.305 | ||
| turn | 0.266 | ||
| sheet | 0.227 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142886.1 | internal | 203 | 1-609(+) |
Amino Acid sequence : | |||
| ESIPVIARKLEGKVAVITGGASGIGECTARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVNKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVNL IGPFLGTKHAARVMIPARCRGSIISMSSIASVNAGITPHGYACSKHGVVGLTKCAAFELGTHGIRVNCVSPQLLSTPLTTGFY | |||
Physicochemical properties | |||
| Number of amino acids: | 203 | ||
| Molecular weight: | 21,273.274 | ||
| Theoretical pI: | 8.230 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5960 6335 | ||
| Instability index: | 29.552 | ||
| aromaticity | 0.054 | ||
| GRAVY | 0.223 | ||
Secondary Structure Fraction | |||
| Helix | 0.305 | ||
| turn | 0.266 | ||
| sheet | 0.227 | ||