| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142895.1 | 5prime_partial | 140 | 1-423(+) |
Amino Acid sequence : | |||
| DKPDLAARRIEAVGFQVGHQLSERYTMERPRFSDHLDAIKFICKDFWSELFKKQIDNLKTNHRGTFVLQDNQFGWAEHLSPNTFSTEAVADSGAAQVTSMYLYFPCGIIRGALSNLGIPC AVSADISNHPACSFVVRIKA* | |||
Physicochemical properties | |||
| Number of amino acids: | 140 | ||
| Molecular weight: | 15,664.614 | ||
| Theoretical pI: | 7.119 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
| Instability index: | 21.784 | ||
| aromaticity | 0.107 | ||
| GRAVY | -0.187 | ||
Secondary Structure Fraction | |||
| Helix | 0.300 | ||
| turn | 0.221 | ||
| sheet | 0.229 | ||