Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX142895.1 | 5prime_partial | 140 | 1-423(+) |
Amino Acid sequence : | |||
DKPDLAARRIEAVGFQVGHQLSERYTMERPRFSDHLDAIKFICKDFWSELFKKQIDNLKTNHRGTFVLQDNQFGWAEHLSPNTFSTEAVADSGAAQVTSMYLYFPCGIIRGALSNLGIPC AVSADISNHPACSFVVRIKA* | |||
Physicochemical properties | |||
Number of amino acids: | 140 | ||
Molecular weight: | 15,664.614 | ||
Theoretical pI: | 7.119 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15470 15720 | ||
Instability index: | 21.784 | ||
aromaticity | 0.107 | ||
GRAVY | -0.187 | ||
Secondary Structure Fraction | |||
Helix | 0.300 | ||
turn | 0.221 | ||
sheet | 0.229 |