| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142897.1 | 5prime_partial | 165 | 3-500(+) |
Amino Acid sequence : | |||
| TRNAKVAFELSERLPHLSLRMKEHSHRALTYSTRMKKMGLKVIYPGLEDHPNHKLLKSMANPGYGFGGMMCVDMGTEERANRLMNHLQNSTEFGLMAVSLGYYETLMSCSGSSTSSELST QDKELAGISPGLVRMSVGYSGTIDQRWGQFEKAISRMQVDVHAKN* | |||
Physicochemical properties | |||
| Number of amino acids: | 165 | ||
| Molecular weight: | 15,465.019 | ||
| Theoretical pI: | 8.714 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 65.506 | ||
| aromaticity | 0.014 | ||
| GRAVY | -1.230 | ||
Secondary Structure Fraction | |||
| Helix | 0.165 | ||
| turn | 0.317 | ||
| sheet | 0.194 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142897.1 | 5prime_partial | 139 | 2-421(+) |
Amino Acid sequence : | |||
| HEECQGGVRALGASPPPLPPNERAQPPGADLLDPHEEDGPQGDLPGPRGPPQPQAPQIHGQPRVRIRRHDVRRHGHRGKGEPSHEPPPELHGVWAHGRLSRVLRDPHVVFREQHQQRVEH SGQGACRHLPRTSQDVCRL* | |||
Physicochemical properties | |||
| Number of amino acids: | 139 | ||
| Molecular weight: | 15,465.019 | ||
| Theoretical pI: | 8.714 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
| Instability index: | 65.506 | ||
| aromaticity | 0.014 | ||
| GRAVY | -1.230 | ||
Secondary Structure Fraction | |||
| Helix | 0.165 | ||
| turn | 0.317 | ||
| sheet | 0.194 | ||