| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142905.1 | internal | 208 | 2-625(+) |
Amino Acid sequence : | |||
| VVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVDKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVNLIGPFLGTKHAARVMIPARCRGSIISMSSIASVNAGITP HGYACSKHGVVGLTKCAAFELGTHGIRVNCVSPQLLSTPLTMGFYNRTEEEVEAVTASVANLKGIIFRAEDVANAVLYLASDESAYVS | |||
Physicochemical properties | |||
| Number of amino acids: | 208 | ||
| Molecular weight: | 22,023.818 | ||
| Theoretical pI: | 5.307 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 9190 | ||
| Instability index: | 28.715 | ||
| aromaticity | 0.063 | ||
| GRAVY | 0.205 | ||
Secondary Structure Fraction | |||
| Helix | 0.317 | ||
| turn | 0.250 | ||
| sheet | 0.260 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142905.1 | internal | 208 | 2-625(+) |
Amino Acid sequence : | |||
| VVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVDKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVNLIGPFLGTKHAARVMIPARCRGSIISMSSIASVNAGITP HGYACSKHGVVGLTKCAAFELGTHGIRVNCVSPQLLSTPLTMGFYNRTEEEVEAVTASVANLKGIIFRAEDVANAVLYLASDESAYVS | |||
Physicochemical properties | |||
| Number of amino acids: | 208 | ||
| Molecular weight: | 22,023.818 | ||
| Theoretical pI: | 5.307 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 9190 | ||
| Instability index: | 28.715 | ||
| aromaticity | 0.063 | ||
| GRAVY | 0.205 | ||
Secondary Structure Fraction | |||
| Helix | 0.317 | ||
| turn | 0.250 | ||
| sheet | 0.260 | ||