| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142932.1 | 3prime_partial | 220 | 87-746(+) |
Amino Acid sequence : | |||
| MAESDVRSEQIHNEEEQEGMSQEQRLKYLDFVHVAAIHSLICLSKLYNFAKENSGPLLPGVQTAEESIKAVVGPVYDKFHNLPFDTLKFVDRKVGESIEEIERHLPSSVKDAAQKAPEVA RSISGEVQRAGVVGTATGLARSAYSKAEPTAKVLYSKYEPVAEHYAVSAWRSLNRLPLFPHMAQIVVPTAAYWSDKYNKVVVNSAEKGYAVSGYLPLVPV | |||
Physicochemical properties | |||
| Number of amino acids: | 220 | ||
| Molecular weight: | 14,308.122 | ||
| Theoretical pI: | 9.873 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22500 | ||
| Instability index: | 84.650 | ||
| aromaticity | 0.038 | ||
| GRAVY | -0.784 | ||
Secondary Structure Fraction | |||
| Helix | 0.159 | ||
| turn | 0.341 | ||
| sheet | 0.159 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142932.1 | 5prime_partial | 132 | 744-346(-) |
Amino Acid sequence : | |||
| QAQEEDIQILHSPSRPSSRQPCCTCRTSRQPLGPQSGPCGGTTGDGSRTATPIPHSAPPQARTCCTAPWQLARPWSRQIGLVRLQCLPRLHAGLPQRWTGPPLVPFGPHPSLKKAGDAQS PQWTPPPCDRRT* | |||
Physicochemical properties | |||
| Number of amino acids: | 132 | ||
| Molecular weight: | 14,308.122 | ||
| Theoretical pI: | 9.873 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22500 | ||
| Instability index: | 84.650 | ||
| aromaticity | 0.038 | ||
| GRAVY | -0.784 | ||
Secondary Structure Fraction | |||
| Helix | 0.159 | ||
| turn | 0.341 | ||
| sheet | 0.159 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142932.1 | 3prime_partial | 220 | 87-746(+) |
Amino Acid sequence : | |||
| MAESDVRSEQIHNEEEQEGMSQEQRLKYLDFVHVAAIHSLICLSKLYNFAKENSGPLLPGVQTAEESIKAVVGPVYDKFHNLPFDTLKFVDRKVGESIEEIERHLPSSVKDAAQKAPEVA RSISGEVQRAGVVGTATGLARSAYSKAEPTAKVLYSKYEPVAEHYAVSAWRSLNRLPLFPHMAQIVVPTAAYWSDKYNKVVVNSAEKGYAVSGYLPLVPV | |||
Physicochemical properties | |||
| Number of amino acids: | 220 | ||
| Molecular weight: | 14,308.122 | ||
| Theoretical pI: | 9.873 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22500 | ||
| Instability index: | 84.650 | ||
| aromaticity | 0.038 | ||
| GRAVY | -0.784 | ||
Secondary Structure Fraction | |||
| Helix | 0.159 | ||
| turn | 0.341 | ||
| sheet | 0.159 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142932.1 | 5prime_partial | 132 | 744-346(-) |
Amino Acid sequence : | |||
| QAQEEDIQILHSPSRPSSRQPCCTCRTSRQPLGPQSGPCGGTTGDGSRTATPIPHSAPPQARTCCTAPWQLARPWSRQIGLVRLQCLPRLHAGLPQRWTGPPLVPFGPHPSLKKAGDAQS PQWTPPPCDRRT* | |||
Physicochemical properties | |||
| Number of amino acids: | 132 | ||
| Molecular weight: | 14,308.122 | ||
| Theoretical pI: | 9.873 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22000 22500 | ||
| Instability index: | 84.650 | ||
| aromaticity | 0.038 | ||
| GRAVY | -0.784 | ||
Secondary Structure Fraction | |||
| Helix | 0.159 | ||
| turn | 0.341 | ||
| sheet | 0.159 | ||