| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142934.1 | 5prime_partial | 185 | 2-559(+) |
Amino Acid sequence : | |||
| IPLRKRAKERRERKMSGPTKKVAEAVAKAVTKKAAIDWEGMARVIVSDESRKELATLRRAFDEVNQQLETKFSQEPETIDWEYYRKGIGSRLVDMYKDAYDKIEIPKFVDNVTPEYKPKF DALLVELKEAEQQSLKESERLEKEIAEAREMKEKISTMTADDYFAKHPELKKKFDDEMRNDNWGY* | |||
Physicochemical properties | |||
| Number of amino acids: | 185 | ||
| Molecular weight: | 21,786.552 | ||
| Theoretical pI: | 6.889 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 26930 | ||
| Instability index: | 39.855 | ||
| aromaticity | 0.086 | ||
| GRAVY | -1.003 | ||
Secondary Structure Fraction | |||
| Helix | 0.249 | ||
| turn | 0.130 | ||
| sheet | 0.319 | ||