| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142940.1 | internal | 115 | 1-345(+) |
Amino Acid sequence : | |||
| ARGRVEHVDHARKSAEQAVKAIKASEEGKQIEEYDYLPFFYSRAFNLSWQFYGDNVGDTVLFGDDDPTSASPKFGSYWIKDGKVVGAFLESGSGEENSAIAKVAKLQPSVSDLEQ | |||
Physicochemical properties | |||
| Number of amino acids: | 115 | ||
| Molecular weight: | 12,681.769 | ||
| Theoretical pI: | 4.848 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18450 | ||
| Instability index: | 39.159 | ||
| aromaticity | 0.122 | ||
| GRAVY | -0.556 | ||
Secondary Structure Fraction | |||
| Helix | 0.287 | ||
| turn | 0.252 | ||
| sheet | 0.243 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142940.1 | internal | 115 | 1-345(+) |
Amino Acid sequence : | |||
| ARGRVEHVDHARKSAEQAVKAIKASEEGKQIEEYDYLPFFYSRAFNLSWQFYGDNVGDTVLFGDDDPTSASPKFGSYWIKDGKVVGAFLESGSGEENSAIAKVAKLQPSVSDLEQ | |||
Physicochemical properties | |||
| Number of amino acids: | 115 | ||
| Molecular weight: | 12,681.769 | ||
| Theoretical pI: | 4.848 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18450 | ||
| Instability index: | 39.159 | ||
| aromaticity | 0.122 | ||
| GRAVY | -0.556 | ||
Secondary Structure Fraction | |||
| Helix | 0.287 | ||
| turn | 0.252 | ||
| sheet | 0.243 | ||