Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX142956.1 | 5prime_partial | 108 | 3-329(+) |
Amino Acid sequence : | |||
SMANPGYGFGGMMCVDMGTEERANRLMNHLQNSTEFGLMAVSLGYYETLMSCSGSSTSSELSTQDKELAGISPGLVRMSVGYSGTIDQRWGQFEKAISRMQVDVHAKN* | |||
Physicochemical properties | |||
Number of amino acids: | 108 | ||
Molecular weight: | 11,728.110 | ||
Theoretical pI: | 5.212 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
Instability index: | 37.985 | ||
aromaticity | 0.074 | ||
GRAVY | -0.311 | ||
Secondary Structure Fraction | |||
Helix | 0.231 | ||
turn | 0.315 | ||
sheet | 0.278 |