| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142966.1 | internal | 189 | 1-567(+) |
Amino Acid sequence : | |||
| ARVFTPLLASTCVGTLEFRSVAEPIGRIQPAISSAPGSYFFLAKCTSLDAESHTVHCETVTDGESKSTLEPWKFKVSYDKLVIASGAEASTFGINGVKEHAIFLREVYHAQEIRRKLLLN LMLSEVPGISEEEKRRLLHCVVIGGGPTGVEFSGELSDFITKDVHERYSHVKDYIHVTLIEANEILSSF | |||
Physicochemical properties | |||
| Number of amino acids: | 189 | ||
| Molecular weight: | 20,869.545 | ||
| Theoretical pI: | 5.757 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13200 | ||
| Instability index: | 38.370 | ||
| aromaticity | 0.085 | ||
| GRAVY | -0.001 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.222 | ||
| sheet | 0.270 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142966.1 | internal | 189 | 1-567(+) |
Amino Acid sequence : | |||
| ARVFTPLLASTCVGTLEFRSVAEPIGRIQPAISSAPGSYFFLAKCTSLDAESHTVHCETVTDGESKSTLEPWKFKVSYDKLVIASGAEASTFGINGVKEHAIFLREVYHAQEIRRKLLLN LMLSEVPGISEEEKRRLLHCVVIGGGPTGVEFSGELSDFITKDVHERYSHVKDYIHVTLIEANEILSSF | |||
Physicochemical properties | |||
| Number of amino acids: | 189 | ||
| Molecular weight: | 20,869.545 | ||
| Theoretical pI: | 5.757 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13200 | ||
| Instability index: | 38.370 | ||
| aromaticity | 0.085 | ||
| GRAVY | -0.001 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.222 | ||
| sheet | 0.270 | ||