Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX142966.1 | internal | 189 | 1-567(+) |
Amino Acid sequence : | |||
ARVFTPLLASTCVGTLEFRSVAEPIGRIQPAISSAPGSYFFLAKCTSLDAESHTVHCETVTDGESKSTLEPWKFKVSYDKLVIASGAEASTFGINGVKEHAIFLREVYHAQEIRRKLLLN LMLSEVPGISEEEKRRLLHCVVIGGGPTGVEFSGELSDFITKDVHERYSHVKDYIHVTLIEANEILSSF | |||
Physicochemical properties | |||
Number of amino acids: | 189 | ||
Molecular weight: | 20,869.545 | ||
Theoretical pI: | 5.757 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13200 | ||
Instability index: | 38.370 | ||
aromaticity | 0.085 | ||
GRAVY | -0.001 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.222 | ||
sheet | 0.270 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX142966.1 | internal | 189 | 1-567(+) |
Amino Acid sequence : | |||
ARVFTPLLASTCVGTLEFRSVAEPIGRIQPAISSAPGSYFFLAKCTSLDAESHTVHCETVTDGESKSTLEPWKFKVSYDKLVIASGAEASTFGINGVKEHAIFLREVYHAQEIRRKLLLN LMLSEVPGISEEEKRRLLHCVVIGGGPTGVEFSGELSDFITKDVHERYSHVKDYIHVTLIEANEILSSF | |||
Physicochemical properties | |||
Number of amino acids: | 189 | ||
Molecular weight: | 20,869.545 | ||
Theoretical pI: | 5.757 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13200 | ||
Instability index: | 38.370 | ||
aromaticity | 0.085 | ||
GRAVY | -0.001 | ||
Secondary Structure Fraction | |||
Helix | 0.333 | ||
turn | 0.222 | ||
sheet | 0.270 |