| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142967.1 | internal | 243 | 2-730(+) |
Amino Acid sequence : | |||
| HEVGSKMNETDVAKQIQQMVRFIRQEAEEKANEISVSAEEEFNIEKLQLVEAEKKKIRQEYERKQKQVEIRKKIEYSMQLNASRIKVLQAQDDLVNSMKEAAGKELLHASEDHHGYRKLL KELIVQSLLRLKEPAVLLRCRKDDHHLVESVLDPAKQEYAEKAKVHPPEIIVDHEVYLPPGPSHEHFHLPFSHHHEHGPFCSGGVVLASRDGKIVLENSLDARLDVAFRRNLPEIRKKLY SQS | |||
Physicochemical properties | |||
| Number of amino acids: | 243 | ||
| Molecular weight: | 28,132.791 | ||
| Theoretical pI: | 6.785 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 9065 | ||
| Instability index: | 49.633 | ||
| aromaticity | 0.049 | ||
| GRAVY | -0.713 | ||
Secondary Structure Fraction | |||
| Helix | 0.284 | ||
| turn | 0.169 | ||
| sheet | 0.313 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX142967.1 | internal | 243 | 2-730(+) |
Amino Acid sequence : | |||
| HEVGSKMNETDVAKQIQQMVRFIRQEAEEKANEISVSAEEEFNIEKLQLVEAEKKKIRQEYERKQKQVEIRKKIEYSMQLNASRIKVLQAQDDLVNSMKEAAGKELLHASEDHHGYRKLL KELIVQSLLRLKEPAVLLRCRKDDHHLVESVLDPAKQEYAEKAKVHPPEIIVDHEVYLPPGPSHEHFHLPFSHHHEHGPFCSGGVVLASRDGKIVLENSLDARLDVAFRRNLPEIRKKLY SQS | |||
Physicochemical properties | |||
| Number of amino acids: | 243 | ||
| Molecular weight: | 28,132.791 | ||
| Theoretical pI: | 6.785 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8940 9065 | ||
| Instability index: | 49.633 | ||
| aromaticity | 0.049 | ||
| GRAVY | -0.713 | ||
Secondary Structure Fraction | |||
| Helix | 0.284 | ||
| turn | 0.169 | ||
| sheet | 0.313 | ||