Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143000.1 | 5prime_partial | 111 | 3-338(+) |
Amino Acid sequence : | |||
LQEFGTREYSLMSRKAIMVLLLLGAAGMFFAKRADAACGMNKEELFSCKPSVSGSNPPKPSEACCSALATADLPCFCKHRNSLMVRLLGIDFDLAMQLPKKCGIPQPRPHC* | |||
Physicochemical properties | |||
Number of amino acids: | 111 | ||
Molecular weight: | 11,314.956 | ||
Theoretical pI: | 9.567 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 83.738 | ||
aromaticity | 0.067 | ||
GRAVY | -0.211 | ||
Secondary Structure Fraction | |||
Helix | 0.212 | ||
turn | 0.308 | ||
sheet | 0.337 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143000.1 | 3prime_partial | 104 | 313-2(-) |
Amino Acid sequence : | |||
MPHFLGSCMARSKSMPSRRTISEFRCLQKHGRSAVANAEQHASEGFGGFEPLTEGLHEKSSSLFMPQAASALLAKNIPAAPRSKSTMMAFLLIREYSLVPNSCS | |||
Physicochemical properties | |||
Number of amino acids: | 104 | ||
Molecular weight: | 11,314.956 | ||
Theoretical pI: | 9.567 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1615 | ||
Instability index: | 83.738 | ||
aromaticity | 0.067 | ||
GRAVY | -0.211 | ||
Secondary Structure Fraction | |||
Helix | 0.212 | ||
turn | 0.308 | ||
sheet | 0.337 |