Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143003.1 | internal | 190 | 2-571(+) |
Amino Acid sequence : | |||
CYFWPSSSDAQRKFEEMWNMVTGQSGGRIASTTIPVMFGRSLEVPESCNGIARFNFEYLCGRPVGAADYIAIARNYHTVFISDIPVMSMRIRDKARRFITLIDEMYNHHCCLFCLAATSI DNLFQGTEEGTLFDLESFQFETETETGKLRRDVLATGSIGLGPAPAEIASLLSGQEELFAFRRAISRLIE | |||
Physicochemical properties | |||
Number of amino acids: | 190 | ||
Molecular weight: | 21,347.095 | ||
Theoretical pI: | 5.169 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18825 | ||
Instability index: | 53.930 | ||
aromaticity | 0.111 | ||
GRAVY | -0.045 | ||
Secondary Structure Fraction | |||
Helix | 0.305 | ||
turn | 0.221 | ||
sheet | 0.279 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143003.1 | internal | 190 | 2-571(+) |
Amino Acid sequence : | |||
CYFWPSSSDAQRKFEEMWNMVTGQSGGRIASTTIPVMFGRSLEVPESCNGIARFNFEYLCGRPVGAADYIAIARNYHTVFISDIPVMSMRIRDKARRFITLIDEMYNHHCCLFCLAATSI DNLFQGTEEGTLFDLESFQFETETETGKLRRDVLATGSIGLGPAPAEIASLLSGQEELFAFRRAISRLIE | |||
Physicochemical properties | |||
Number of amino acids: | 190 | ||
Molecular weight: | 21,347.095 | ||
Theoretical pI: | 5.169 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18825 | ||
Instability index: | 53.930 | ||
aromaticity | 0.111 | ||
GRAVY | -0.045 | ||
Secondary Structure Fraction | |||
Helix | 0.305 | ||
turn | 0.221 | ||
sheet | 0.279 |