| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143005.1 | internal | 183 | 3-551(+) |
Amino Acid sequence : | |||
| SPGLQEFGTRVHGIDVFDPKFNIVSPGADMSIYFPYYEEHRRLTALHSQIEELLYNPIDNSEHKGFLKDRIKPIIFSMARLDRVKNITGLVELYGRNPRLKELVNLVVVAGDHVKESKDH EEIEEKKKMYRLINEYELEGHIRWISAQMNRVRNGELYRCIADTKGAFVQPALYEAFGLTVIE | |||
Physicochemical properties | |||
| Number of amino acids: | 183 | ||
| Molecular weight: | 21,248.073 | ||
| Theoretical pI: | 6.180 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18910 18910 | ||
| Instability index: | 47.581 | ||
| aromaticity | 0.098 | ||
| GRAVY | -0.415 | ||
Secondary Structure Fraction | |||
| Helix | 0.344 | ||
| turn | 0.202 | ||
| sheet | 0.268 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143005.1 | internal | 183 | 3-551(+) |
Amino Acid sequence : | |||
| SPGLQEFGTRVHGIDVFDPKFNIVSPGADMSIYFPYYEEHRRLTALHSQIEELLYNPIDNSEHKGFLKDRIKPIIFSMARLDRVKNITGLVELYGRNPRLKELVNLVVVAGDHVKESKDH EEIEEKKKMYRLINEYELEGHIRWISAQMNRVRNGELYRCIADTKGAFVQPALYEAFGLTVIE | |||
Physicochemical properties | |||
| Number of amino acids: | 183 | ||
| Molecular weight: | 21,248.073 | ||
| Theoretical pI: | 6.180 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18910 18910 | ||
| Instability index: | 47.581 | ||
| aromaticity | 0.098 | ||
| GRAVY | -0.415 | ||
Secondary Structure Fraction | |||
| Helix | 0.344 | ||
| turn | 0.202 | ||
| sheet | 0.268 | ||