Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143005.1 | internal | 183 | 3-551(+) |
Amino Acid sequence : | |||
SPGLQEFGTRVHGIDVFDPKFNIVSPGADMSIYFPYYEEHRRLTALHSQIEELLYNPIDNSEHKGFLKDRIKPIIFSMARLDRVKNITGLVELYGRNPRLKELVNLVVVAGDHVKESKDH EEIEEKKKMYRLINEYELEGHIRWISAQMNRVRNGELYRCIADTKGAFVQPALYEAFGLTVIE | |||
Physicochemical properties | |||
Number of amino acids: | 183 | ||
Molecular weight: | 21,248.073 | ||
Theoretical pI: | 6.180 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18910 18910 | ||
Instability index: | 47.581 | ||
aromaticity | 0.098 | ||
GRAVY | -0.415 | ||
Secondary Structure Fraction | |||
Helix | 0.344 | ||
turn | 0.202 | ||
sheet | 0.268 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143005.1 | internal | 183 | 3-551(+) |
Amino Acid sequence : | |||
SPGLQEFGTRVHGIDVFDPKFNIVSPGADMSIYFPYYEEHRRLTALHSQIEELLYNPIDNSEHKGFLKDRIKPIIFSMARLDRVKNITGLVELYGRNPRLKELVNLVVVAGDHVKESKDH EEIEEKKKMYRLINEYELEGHIRWISAQMNRVRNGELYRCIADTKGAFVQPALYEAFGLTVIE | |||
Physicochemical properties | |||
Number of amino acids: | 183 | ||
Molecular weight: | 21,248.073 | ||
Theoretical pI: | 6.180 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18910 18910 | ||
Instability index: | 47.581 | ||
aromaticity | 0.098 | ||
GRAVY | -0.415 | ||
Secondary Structure Fraction | |||
Helix | 0.344 | ||
turn | 0.202 | ||
sheet | 0.268 |