Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143007.1 | 5prime_partial | 155 | 1-468(+) |
Amino Acid sequence : | |||
FSIKMSIISFPTSCTIKCNFRTHSPYALAKGPTSLGSFKNVSKSFGLKQSSCFKATAMAVYKVKLVTPEGEEHEFEAPDDAYILDSAETAGLELPYSCRAGACSTCAGKIVSGSVDQSDG SFLDESQVENGYALTCVSYPTADCVIHTHKESDLY* | |||
Physicochemical properties | |||
Number of amino acids: | 155 | ||
Molecular weight: | 16,636.546 | ||
Theoretical pI: | 5.296 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 10430 10930 | ||
Instability index: | 41.484 | ||
aromaticity | 0.097 | ||
GRAVY | -0.121 | ||
Secondary Structure Fraction | |||
Helix | 0.265 | ||
turn | 0.265 | ||
sheet | 0.232 |