| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143010.1 | internal | 140 | 3-422(+) |
Amino Acid sequence : | |||
| RSSQSIEMSLVPFGFGSLVFDPWDPIDSLFRDVVPRANSNFPSGEISAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERSSGKFMRRFRM PENAKVEEVKASMENGVLTV | |||
Physicochemical properties | |||
| Number of amino acids: | 140 | ||
| Molecular weight: | 13,764.030 | ||
| Theoretical pI: | 10.332 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 53.314 | ||
| aromaticity | 0.025 | ||
| GRAVY | -0.056 | ||
Secondary Structure Fraction | |||
| Helix | 0.369 | ||
| turn | 0.221 | ||
| sheet | 0.352 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143010.1 | 5prime_partial | 137 | 424-11(-) |
Amino Acid sequence : | |||
| VTVRTPFSIEAFTSSTFAFSGIRNLLINFPLLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSALNTCASGVSFQSMRVLANAEISPLGKFEFARGTTSRKRLSIGSQG SNTRDPNPNGTSDISID* | |||
Physicochemical properties | |||
| Number of amino acids: | 137 | ||
| Molecular weight: | 13,764.030 | ||
| Theoretical pI: | 10.332 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 53.314 | ||
| aromaticity | 0.025 | ||
| GRAVY | -0.056 | ||
Secondary Structure Fraction | |||
| Helix | 0.369 | ||
| turn | 0.221 | ||
| sheet | 0.352 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143010.1 | 5prime_partial | 122 | 422-54(-) |
Amino Acid sequence : | |||
| NGKNSVLHRSLHLLHLRVLRHPEPPHKLPAAPLHTVPRVVLLLLLLPPLPADLEDPPFLHFHLHLLLLDSGEVGLEHVRLRRLLPVYAGVGERRNLAARKVRVRTGNHVAEEAIDRIPGI EH* | |||
Physicochemical properties | |||
| Number of amino acids: | 122 | ||
| Molecular weight: | 13,764.030 | ||
| Theoretical pI: | 10.332 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 53.314 | ||
| aromaticity | 0.025 | ||
| GRAVY | -0.056 | ||
Secondary Structure Fraction | |||
| Helix | 0.369 | ||
| turn | 0.221 | ||
| sheet | 0.352 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143010.1 | internal | 140 | 3-422(+) |
Amino Acid sequence : | |||
| RSSQSIEMSLVPFGFGSLVFDPWDPIDSLFRDVVPRANSNFPSGEISAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERSSGKFMRRFRM PENAKVEEVKASMENGVLTV | |||
Physicochemical properties | |||
| Number of amino acids: | 140 | ||
| Molecular weight: | 13,764.030 | ||
| Theoretical pI: | 10.332 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 53.314 | ||
| aromaticity | 0.025 | ||
| GRAVY | -0.056 | ||
Secondary Structure Fraction | |||
| Helix | 0.369 | ||
| turn | 0.221 | ||
| sheet | 0.352 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143010.1 | 5prime_partial | 137 | 424-11(-) |
Amino Acid sequence : | |||
| VTVRTPFSIEAFTSSTFAFSGIRNLLINFPLLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSALNTCASGVSFQSMRVLANAEISPLGKFEFARGTTSRKRLSIGSQG SNTRDPNPNGTSDISID* | |||
Physicochemical properties | |||
| Number of amino acids: | 137 | ||
| Molecular weight: | 13,764.030 | ||
| Theoretical pI: | 10.332 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 53.314 | ||
| aromaticity | 0.025 | ||
| GRAVY | -0.056 | ||
Secondary Structure Fraction | |||
| Helix | 0.369 | ||
| turn | 0.221 | ||
| sheet | 0.352 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143010.1 | 5prime_partial | 122 | 422-54(-) |
Amino Acid sequence : | |||
| NGKNSVLHRSLHLLHLRVLRHPEPPHKLPAAPLHTVPRVVLLLLLLPPLPADLEDPPFLHFHLHLLLLDSGEVGLEHVRLRRLLPVYAGVGERRNLAARKVRVRTGNHVAEEAIDRIPGI EH* | |||
Physicochemical properties | |||
| Number of amino acids: | 122 | ||
| Molecular weight: | 13,764.030 | ||
| Theoretical pI: | 10.332 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 53.314 | ||
| aromaticity | 0.025 | ||
| GRAVY | -0.056 | ||
Secondary Structure Fraction | |||
| Helix | 0.369 | ||
| turn | 0.221 | ||
| sheet | 0.352 | ||