Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143010.1 | internal | 140 | 3-422(+) |
Amino Acid sequence : | |||
RSSQSIEMSLVPFGFGSLVFDPWDPIDSLFRDVVPRANSNFPSGEISAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERSSGKFMRRFRM PENAKVEEVKASMENGVLTV | |||
Physicochemical properties | |||
Number of amino acids: | 140 | ||
Molecular weight: | 13,764.030 | ||
Theoretical pI: | 10.332 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 53.314 | ||
aromaticity | 0.025 | ||
GRAVY | -0.056 | ||
Secondary Structure Fraction | |||
Helix | 0.369 | ||
turn | 0.221 | ||
sheet | 0.352 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143010.1 | 5prime_partial | 137 | 424-11(-) |
Amino Acid sequence : | |||
VTVRTPFSIEAFTSSTFAFSGIRNLLINFPLLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSALNTCASGVSFQSMRVLANAEISPLGKFEFARGTTSRKRLSIGSQG SNTRDPNPNGTSDISID* | |||
Physicochemical properties | |||
Number of amino acids: | 137 | ||
Molecular weight: | 13,764.030 | ||
Theoretical pI: | 10.332 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 53.314 | ||
aromaticity | 0.025 | ||
GRAVY | -0.056 | ||
Secondary Structure Fraction | |||
Helix | 0.369 | ||
turn | 0.221 | ||
sheet | 0.352 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143010.1 | 5prime_partial | 122 | 422-54(-) |
Amino Acid sequence : | |||
NGKNSVLHRSLHLLHLRVLRHPEPPHKLPAAPLHTVPRVVLLLLLLPPLPADLEDPPFLHFHLHLLLLDSGEVGLEHVRLRRLLPVYAGVGERRNLAARKVRVRTGNHVAEEAIDRIPGI EH* | |||
Physicochemical properties | |||
Number of amino acids: | 122 | ||
Molecular weight: | 13,764.030 | ||
Theoretical pI: | 10.332 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 53.314 | ||
aromaticity | 0.025 | ||
GRAVY | -0.056 | ||
Secondary Structure Fraction | |||
Helix | 0.369 | ||
turn | 0.221 | ||
sheet | 0.352 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143010.1 | internal | 140 | 3-422(+) |
Amino Acid sequence : | |||
RSSQSIEMSLVPFGFGSLVFDPWDPIDSLFRDVVPRANSNFPSGEISAFANTRIDWKETPEAHVFKADLPGIKKEEVKVEVEEGRILQISGERRKEQEEKNDTWHRVERSSGKFMRRFRM PENAKVEEVKASMENGVLTV | |||
Physicochemical properties | |||
Number of amino acids: | 140 | ||
Molecular weight: | 13,764.030 | ||
Theoretical pI: | 10.332 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 53.314 | ||
aromaticity | 0.025 | ||
GRAVY | -0.056 | ||
Secondary Structure Fraction | |||
Helix | 0.369 | ||
turn | 0.221 | ||
sheet | 0.352 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143010.1 | 5prime_partial | 137 | 424-11(-) |
Amino Acid sequence : | |||
VTVRTPFSIEAFTSSTFAFSGIRNLLINFPLLLSTRCHVSFFSSCSFLLSPLIWRILPSSTSTFTSSFLIPGRSALNTCASGVSFQSMRVLANAEISPLGKFEFARGTTSRKRLSIGSQG SNTRDPNPNGTSDISID* | |||
Physicochemical properties | |||
Number of amino acids: | 137 | ||
Molecular weight: | 13,764.030 | ||
Theoretical pI: | 10.332 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 53.314 | ||
aromaticity | 0.025 | ||
GRAVY | -0.056 | ||
Secondary Structure Fraction | |||
Helix | 0.369 | ||
turn | 0.221 | ||
sheet | 0.352 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143010.1 | 5prime_partial | 122 | 422-54(-) |
Amino Acid sequence : | |||
NGKNSVLHRSLHLLHLRVLRHPEPPHKLPAAPLHTVPRVVLLLLLLPPLPADLEDPPFLHFHLHLLLLDSGEVGLEHVRLRRLLPVYAGVGERRNLAARKVRVRTGNHVAEEAIDRIPGI EH* | |||
Physicochemical properties | |||
Number of amino acids: | 122 | ||
Molecular weight: | 13,764.030 | ||
Theoretical pI: | 10.332 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
Instability index: | 53.314 | ||
aromaticity | 0.025 | ||
GRAVY | -0.056 | ||
Secondary Structure Fraction | |||
Helix | 0.369 | ||
turn | 0.221 | ||
sheet | 0.352 |