| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143023.1 | 5prime_partial | 126 | 2-382(+) |
Amino Acid sequence : | |||
| NLVFCYLNEEWSNMNQNGAPPDLPISESIWSNLPHNVEKRKLKVPQQKNEYDCGLFVLYFMERFIEEAPERLKKKDLDMFGSKWFDPEEASGLRKRIRGLLIKESPSSFSHDNIEQHIVL DTSNRS* | |||
Physicochemical properties | |||
| Number of amino acids: | 126 | ||
| Molecular weight: | 14,800.583 | ||
| Theoretical pI: | 5.644 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21095 | ||
| Instability index: | 64.040 | ||
| aromaticity | 0.103 | ||
| GRAVY | -0.740 | ||
Secondary Structure Fraction | |||
| Helix | 0.302 | ||
| turn | 0.278 | ||
| sheet | 0.254 | ||