| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143055.1 | 5prime_partial | 155 | 2-469(+) |
Amino Acid sequence : | |||
| NNLDQLRKGMQSAIEIQRAILRQGSSAITRSGFIRSGRKFRWIKLEDPVDTEQLRYPQALTKFCYFLMDALKERGARMKPLICACLAKEPDRVLIVGICGRPQFGALQGNSFGIAFKTAA EEIEAEHFHEFFESSWIVLSTVSVSSFMIRLTDKL* | |||
Physicochemical properties | |||
| Number of amino acids: | 155 | ||
| Molecular weight: | 17,604.264 | ||
| Theoretical pI: | 9.208 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
| Instability index: | 45.295 | ||
| aromaticity | 0.097 | ||
| GRAVY | -0.101 | ||
Secondary Structure Fraction | |||
| Helix | 0.316 | ||
| turn | 0.194 | ||
| sheet | 0.277 | ||