Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143055.1 | 5prime_partial | 155 | 2-469(+) |
Amino Acid sequence : | |||
NNLDQLRKGMQSAIEIQRAILRQGSSAITRSGFIRSGRKFRWIKLEDPVDTEQLRYPQALTKFCYFLMDALKERGARMKPLICACLAKEPDRVLIVGICGRPQFGALQGNSFGIAFKTAA EEIEAEHFHEFFESSWIVLSTVSVSSFMIRLTDKL* | |||
Physicochemical properties | |||
Number of amino acids: | 155 | ||
Molecular weight: | 17,604.264 | ||
Theoretical pI: | 9.208 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 13980 14230 | ||
Instability index: | 45.295 | ||
aromaticity | 0.097 | ||
GRAVY | -0.101 | ||
Secondary Structure Fraction | |||
Helix | 0.316 | ||
turn | 0.194 | ||
sheet | 0.277 |