| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143057.1 | internal | 185 | 2-556(+) |
Amino Acid sequence : | |||
| HERTCAQDERLNISVTPESGMLPMQTMYSSNGWDSYAWAFKAKLSNVCLVIHNPGVEEDPACGPLIDSVAIKTLYPPKHTNTNLLKNGDFEEGPYILPNTSWGVLIPPNIEDDHSPLPGW IIESLKAIKYIDAPHFSIPKGRRAVELVAGKESALAQIVRTIPGKIYTLAFAVGDAANSCEGSMI | |||
Physicochemical properties | |||
| Number of amino acids: | 185 | ||
| Molecular weight: | 20,187.831 | ||
| Theoretical pI: | 5.319 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30940 31190 | ||
| Instability index: | 43.634 | ||
| aromaticity | 0.076 | ||
| GRAVY | -0.149 | ||
Secondary Structure Fraction | |||
| Helix | 0.297 | ||
| turn | 0.286 | ||
| sheet | 0.254 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143057.1 | internal | 185 | 2-556(+) |
Amino Acid sequence : | |||
| HERTCAQDERLNISVTPESGMLPMQTMYSSNGWDSYAWAFKAKLSNVCLVIHNPGVEEDPACGPLIDSVAIKTLYPPKHTNTNLLKNGDFEEGPYILPNTSWGVLIPPNIEDDHSPLPGW IIESLKAIKYIDAPHFSIPKGRRAVELVAGKESALAQIVRTIPGKIYTLAFAVGDAANSCEGSMI | |||
Physicochemical properties | |||
| Number of amino acids: | 185 | ||
| Molecular weight: | 20,187.831 | ||
| Theoretical pI: | 5.319 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30940 31190 | ||
| Instability index: | 43.634 | ||
| aromaticity | 0.076 | ||
| GRAVY | -0.149 | ||
Secondary Structure Fraction | |||
| Helix | 0.297 | ||
| turn | 0.286 | ||
| sheet | 0.254 | ||