Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143069.1 | 3prime_partial | 111 | 334-2(-) |
Amino Acid sequence : | |||
MSRTYSIGTASDDIHSHLSRICCLQLHLNPIQLPLEPVLRAGIKHLASHSRDVWRPCNEEDLALLAVLLSHKIKVINGISAFILREAGSEVLIAQGRFSYLLHNNLLQLLV | |||
Physicochemical properties | |||
Number of amino acids: | 111 | ||
Molecular weight: | 12,149.589 | ||
Theoretical pI: | 4.777 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
Instability index: | 44.518 | ||
aromaticity | 0.105 | ||
GRAVY | -0.540 | ||
Secondary Structure Fraction | |||
Helix | 0.295 | ||
turn | 0.181 | ||
sheet | 0.257 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143069.1 | 5prime_partial | 105 | 2-319(+) |
Amino Acid sequence : | |||
DEKLKQVIVEKVGEPALSYEDFTASLPENECRYAIYDFDFVTEENCQKSKIFFIAWSPDISRVRSKMLYASSKDRFKRELDGIQVELQATDPTEMGMDVIRGRAN* | |||
Physicochemical properties | |||
Number of amino acids: | 105 | ||
Molecular weight: | 12,149.589 | ||
Theoretical pI: | 4.777 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
Instability index: | 44.518 | ||
aromaticity | 0.105 | ||
GRAVY | -0.540 | ||
Secondary Structure Fraction | |||
Helix | 0.295 | ||
turn | 0.181 | ||
sheet | 0.257 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143069.1 | 3prime_partial | 111 | 334-2(-) |
Amino Acid sequence : | |||
MSRTYSIGTASDDIHSHLSRICCLQLHLNPIQLPLEPVLRAGIKHLASHSRDVWRPCNEEDLALLAVLLSHKIKVINGISAFILREAGSEVLIAQGRFSYLLHNNLLQLLV | |||
Physicochemical properties | |||
Number of amino acids: | 111 | ||
Molecular weight: | 12,149.589 | ||
Theoretical pI: | 4.777 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
Instability index: | 44.518 | ||
aromaticity | 0.105 | ||
GRAVY | -0.540 | ||
Secondary Structure Fraction | |||
Helix | 0.295 | ||
turn | 0.181 | ||
sheet | 0.257 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143069.1 | 5prime_partial | 105 | 2-319(+) |
Amino Acid sequence : | |||
DEKLKQVIVEKVGEPALSYEDFTASLPENECRYAIYDFDFVTEENCQKSKIFFIAWSPDISRVRSKMLYASSKDRFKRELDGIQVELQATDPTEMGMDVIRGRAN* | |||
Physicochemical properties | |||
Number of amino acids: | 105 | ||
Molecular weight: | 12,149.589 | ||
Theoretical pI: | 4.777 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
Instability index: | 44.518 | ||
aromaticity | 0.105 | ||
GRAVY | -0.540 | ||
Secondary Structure Fraction | |||
Helix | 0.295 | ||
turn | 0.181 | ||
sheet | 0.257 |