| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143069.1 | 3prime_partial | 111 | 334-2(-) |
Amino Acid sequence : | |||
| MSRTYSIGTASDDIHSHLSRICCLQLHLNPIQLPLEPVLRAGIKHLASHSRDVWRPCNEEDLALLAVLLSHKIKVINGISAFILREAGSEVLIAQGRFSYLLHNNLLQLLV | |||
Physicochemical properties | |||
| Number of amino acids: | 111 | ||
| Molecular weight: | 12,149.589 | ||
| Theoretical pI: | 4.777 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
| Instability index: | 44.518 | ||
| aromaticity | 0.105 | ||
| GRAVY | -0.540 | ||
Secondary Structure Fraction | |||
| Helix | 0.295 | ||
| turn | 0.181 | ||
| sheet | 0.257 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143069.1 | 5prime_partial | 105 | 2-319(+) |
Amino Acid sequence : | |||
| DEKLKQVIVEKVGEPALSYEDFTASLPENECRYAIYDFDFVTEENCQKSKIFFIAWSPDISRVRSKMLYASSKDRFKRELDGIQVELQATDPTEMGMDVIRGRAN* | |||
Physicochemical properties | |||
| Number of amino acids: | 105 | ||
| Molecular weight: | 12,149.589 | ||
| Theoretical pI: | 4.777 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
| Instability index: | 44.518 | ||
| aromaticity | 0.105 | ||
| GRAVY | -0.540 | ||
Secondary Structure Fraction | |||
| Helix | 0.295 | ||
| turn | 0.181 | ||
| sheet | 0.257 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143069.1 | 3prime_partial | 111 | 334-2(-) |
Amino Acid sequence : | |||
| MSRTYSIGTASDDIHSHLSRICCLQLHLNPIQLPLEPVLRAGIKHLASHSRDVWRPCNEEDLALLAVLLSHKIKVINGISAFILREAGSEVLIAQGRFSYLLHNNLLQLLV | |||
Physicochemical properties | |||
| Number of amino acids: | 111 | ||
| Molecular weight: | 12,149.589 | ||
| Theoretical pI: | 4.777 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
| Instability index: | 44.518 | ||
| aromaticity | 0.105 | ||
| GRAVY | -0.540 | ||
Secondary Structure Fraction | |||
| Helix | 0.295 | ||
| turn | 0.181 | ||
| sheet | 0.257 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143069.1 | 5prime_partial | 105 | 2-319(+) |
Amino Acid sequence : | |||
| DEKLKQVIVEKVGEPALSYEDFTASLPENECRYAIYDFDFVTEENCQKSKIFFIAWSPDISRVRSKMLYASSKDRFKRELDGIQVELQATDPTEMGMDVIRGRAN* | |||
Physicochemical properties | |||
| Number of amino acids: | 105 | ||
| Molecular weight: | 12,149.589 | ||
| Theoretical pI: | 4.777 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
| Instability index: | 44.518 | ||
| aromaticity | 0.105 | ||
| GRAVY | -0.540 | ||
Secondary Structure Fraction | |||
| Helix | 0.295 | ||
| turn | 0.181 | ||
| sheet | 0.257 | ||