| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143070.1 | 3prime_partial | 188 | 1-564(+) |
Amino Acid sequence : | |||
| MSLLTDFINLDISSGNKIIAEYIWIGGSGTDIRSKARTLTGPITSPSQLPKWNYDGSSTGQAPGEDSEVILYPQAIFKDPFRRGDNILVMCDCYTPAGEPIPTNKRANAAKIFSHPDVAA EVTWYGLEQEYTLLQKDVKWPLGWPIGGFPGPQGPYYCAAGADKAFGRDIVDAHYKACIYAGINISGI | |||
Physicochemical properties | |||
| Number of amino acids: | 188 | ||
| Molecular weight: | 12,890.643 | ||
| Theoretical pI: | 9.378 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
| Instability index: | 53.650 | ||
| aromaticity | 0.061 | ||
| GRAVY | -0.271 | ||
Secondary Structure Fraction | |||
| Helix | 0.296 | ||
| turn | 0.270 | ||
| sheet | 0.209 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143070.1 | 3prime_partial | 115 | 345-1(-) |
Amino Acid sequence : | |||
| MAKNLSSISSFICRDWLPGRGIAITHNKDIVPSPERVLENGLRIQNHFTVLPRSLTCARSIVVPLRKLARARDRPSKRPCFASNVRATSSNPYVFSYDLVAGGDVEVDEICEERH | |||
Physicochemical properties | |||
| Number of amino acids: | 115 | ||
| Molecular weight: | 12,890.643 | ||
| Theoretical pI: | 9.378 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
| Instability index: | 53.650 | ||
| aromaticity | 0.061 | ||
| GRAVY | -0.271 | ||
Secondary Structure Fraction | |||
| Helix | 0.296 | ||
| turn | 0.270 | ||
| sheet | 0.209 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143070.1 | 3prime_partial | 188 | 1-564(+) |
Amino Acid sequence : | |||
| MSLLTDFINLDISSGNKIIAEYIWIGGSGTDIRSKARTLTGPITSPSQLPKWNYDGSSTGQAPGEDSEVILYPQAIFKDPFRRGDNILVMCDCYTPAGEPIPTNKRANAAKIFSHPDVAA EVTWYGLEQEYTLLQKDVKWPLGWPIGGFPGPQGPYYCAAGADKAFGRDIVDAHYKACIYAGINISGI | |||
Physicochemical properties | |||
| Number of amino acids: | 188 | ||
| Molecular weight: | 12,890.643 | ||
| Theoretical pI: | 9.378 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
| Instability index: | 53.650 | ||
| aromaticity | 0.061 | ||
| GRAVY | -0.271 | ||
Secondary Structure Fraction | |||
| Helix | 0.296 | ||
| turn | 0.270 | ||
| sheet | 0.209 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143070.1 | 3prime_partial | 115 | 345-1(-) |
Amino Acid sequence : | |||
| MAKNLSSISSFICRDWLPGRGIAITHNKDIVPSPERVLENGLRIQNHFTVLPRSLTCARSIVVPLRKLARARDRPSKRPCFASNVRATSSNPYVFSYDLVAGGDVEVDEICEERH | |||
Physicochemical properties | |||
| Number of amino acids: | 115 | ||
| Molecular weight: | 12,890.643 | ||
| Theoretical pI: | 9.378 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8730 | ||
| Instability index: | 53.650 | ||
| aromaticity | 0.061 | ||
| GRAVY | -0.271 | ||
Secondary Structure Fraction | |||
| Helix | 0.296 | ||
| turn | 0.270 | ||
| sheet | 0.209 | ||