Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143077.1 | internal | 194 | 2-583(+) |
Amino Acid sequence : | |||
HEVGSKMNETDVAKQIQQMVRFIRQEAEEKANEISVSAEEEFNIEKLQLVEAEKKKIRQEYERKQKQVEIRKKIEYSMQLNASRIKVLQAQDDLVNSMKEAAGKELLHASEDHHGYRKLL KELIVQSLLRLKEPAVLLRCRKDDHHLVESVLDPAKQEYAEKAKVHPPEIIVDHEVYLPPGPSHEHFHLPFSHH | |||
Physicochemical properties | |||
Number of amino acids: | 194 | ||
Molecular weight: | 22,670.624 | ||
Theoretical pI: | 6.376 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7450 | ||
Instability index: | 49.967 | ||
aromaticity | 0.046 | ||
GRAVY | -0.790 | ||
Secondary Structure Fraction | |||
Helix | 0.278 | ||
turn | 0.144 | ||
sheet | 0.330 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143077.1 | internal | 194 | 2-583(+) |
Amino Acid sequence : | |||
HEVGSKMNETDVAKQIQQMVRFIRQEAEEKANEISVSAEEEFNIEKLQLVEAEKKKIRQEYERKQKQVEIRKKIEYSMQLNASRIKVLQAQDDLVNSMKEAAGKELLHASEDHHGYRKLL KELIVQSLLRLKEPAVLLRCRKDDHHLVESVLDPAKQEYAEKAKVHPPEIIVDHEVYLPPGPSHEHFHLPFSHH | |||
Physicochemical properties | |||
Number of amino acids: | 194 | ||
Molecular weight: | 22,670.624 | ||
Theoretical pI: | 6.376 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7450 | ||
Instability index: | 49.967 | ||
aromaticity | 0.046 | ||
GRAVY | -0.790 | ||
Secondary Structure Fraction | |||
Helix | 0.278 | ||
turn | 0.144 | ||
sheet | 0.330 |