| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143077.1 | internal | 194 | 2-583(+) |
Amino Acid sequence : | |||
| HEVGSKMNETDVAKQIQQMVRFIRQEAEEKANEISVSAEEEFNIEKLQLVEAEKKKIRQEYERKQKQVEIRKKIEYSMQLNASRIKVLQAQDDLVNSMKEAAGKELLHASEDHHGYRKLL KELIVQSLLRLKEPAVLLRCRKDDHHLVESVLDPAKQEYAEKAKVHPPEIIVDHEVYLPPGPSHEHFHLPFSHH | |||
Physicochemical properties | |||
| Number of amino acids: | 194 | ||
| Molecular weight: | 22,670.624 | ||
| Theoretical pI: | 6.376 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7450 | ||
| Instability index: | 49.967 | ||
| aromaticity | 0.046 | ||
| GRAVY | -0.790 | ||
Secondary Structure Fraction | |||
| Helix | 0.278 | ||
| turn | 0.144 | ||
| sheet | 0.330 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143077.1 | internal | 194 | 2-583(+) |
Amino Acid sequence : | |||
| HEVGSKMNETDVAKQIQQMVRFIRQEAEEKANEISVSAEEEFNIEKLQLVEAEKKKIRQEYERKQKQVEIRKKIEYSMQLNASRIKVLQAQDDLVNSMKEAAGKELLHASEDHHGYRKLL KELIVQSLLRLKEPAVLLRCRKDDHHLVESVLDPAKQEYAEKAKVHPPEIIVDHEVYLPPGPSHEHFHLPFSHH | |||
Physicochemical properties | |||
| Number of amino acids: | 194 | ||
| Molecular weight: | 22,670.624 | ||
| Theoretical pI: | 6.376 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7450 | ||
| Instability index: | 49.967 | ||
| aromaticity | 0.046 | ||
| GRAVY | -0.790 | ||
Secondary Structure Fraction | |||
| Helix | 0.278 | ||
| turn | 0.144 | ||
| sheet | 0.330 | ||