Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143079.1 | internal | 225 | 3-677(+) |
Amino Acid sequence : | |||
RRSSGLVALLALQVASEYHRLGWKPPVTTGLLLTNTLIYLRPGPLDRILPHLDQVAFNPNYILKYGDLKRFFLSAFYHMGESHLFYNMTSLLWKGIQLETSMGSVDFASMVASLLCLSQG MTLILAKSLLLFFDYETAYYRQFGVGFSGVLFAMKVVLNSQSDGYSDVYGAQIPSRHAAWAELILIQLFVPGVSFLGHLGGIIAGLVYLRLRNHYSGFDPLAALI | |||
Physicochemical properties | |||
Number of amino acids: | 225 | ||
Molecular weight: | 25,060.992 | ||
Theoretical pI: | 8.952 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35870 35870 | ||
Instability index: | 36.526 | ||
aromaticity | 0.133 | ||
GRAVY | 0.426 | ||
Secondary Structure Fraction | |||
Helix | 0.422 | ||
turn | 0.240 | ||
sheet | 0.302 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143079.1 | internal | 225 | 3-677(+) |
Amino Acid sequence : | |||
RRSSGLVALLALQVASEYHRLGWKPPVTTGLLLTNTLIYLRPGPLDRILPHLDQVAFNPNYILKYGDLKRFFLSAFYHMGESHLFYNMTSLLWKGIQLETSMGSVDFASMVASLLCLSQG MTLILAKSLLLFFDYETAYYRQFGVGFSGVLFAMKVVLNSQSDGYSDVYGAQIPSRHAAWAELILIQLFVPGVSFLGHLGGIIAGLVYLRLRNHYSGFDPLAALI | |||
Physicochemical properties | |||
Number of amino acids: | 225 | ||
Molecular weight: | 25,060.992 | ||
Theoretical pI: | 8.952 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35870 35870 | ||
Instability index: | 36.526 | ||
aromaticity | 0.133 | ||
GRAVY | 0.426 | ||
Secondary Structure Fraction | |||
Helix | 0.422 | ||
turn | 0.240 | ||
sheet | 0.302 |