| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143079.1 | internal | 225 | 3-677(+) |
Amino Acid sequence : | |||
| RRSSGLVALLALQVASEYHRLGWKPPVTTGLLLTNTLIYLRPGPLDRILPHLDQVAFNPNYILKYGDLKRFFLSAFYHMGESHLFYNMTSLLWKGIQLETSMGSVDFASMVASLLCLSQG MTLILAKSLLLFFDYETAYYRQFGVGFSGVLFAMKVVLNSQSDGYSDVYGAQIPSRHAAWAELILIQLFVPGVSFLGHLGGIIAGLVYLRLRNHYSGFDPLAALI | |||
Physicochemical properties | |||
| Number of amino acids: | 225 | ||
| Molecular weight: | 25,060.992 | ||
| Theoretical pI: | 8.952 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35870 35870 | ||
| Instability index: | 36.526 | ||
| aromaticity | 0.133 | ||
| GRAVY | 0.426 | ||
Secondary Structure Fraction | |||
| Helix | 0.422 | ||
| turn | 0.240 | ||
| sheet | 0.302 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143079.1 | internal | 225 | 3-677(+) |
Amino Acid sequence : | |||
| RRSSGLVALLALQVASEYHRLGWKPPVTTGLLLTNTLIYLRPGPLDRILPHLDQVAFNPNYILKYGDLKRFFLSAFYHMGESHLFYNMTSLLWKGIQLETSMGSVDFASMVASLLCLSQG MTLILAKSLLLFFDYETAYYRQFGVGFSGVLFAMKVVLNSQSDGYSDVYGAQIPSRHAAWAELILIQLFVPGVSFLGHLGGIIAGLVYLRLRNHYSGFDPLAALI | |||
Physicochemical properties | |||
| Number of amino acids: | 225 | ||
| Molecular weight: | 25,060.992 | ||
| Theoretical pI: | 8.952 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 35870 35870 | ||
| Instability index: | 36.526 | ||
| aromaticity | 0.133 | ||
| GRAVY | 0.426 | ||
Secondary Structure Fraction | |||
| Helix | 0.422 | ||
| turn | 0.240 | ||
| sheet | 0.302 | ||