| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143081.1 | 3prime_partial | 177 | 35-565(+) |
Amino Acid sequence : | |||
| MESIPVIARKLEGKVAVITGGASGIGECTARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVDKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVN LIGPFLGTKHAARVMIPARCRGSIISMSSIASVNAGITPHGYACSKHGVVGLTKCAA | |||
Physicochemical properties | |||
| Number of amino acids: | 177 | ||
| Molecular weight: | 18,472.115 | ||
| Theoretical pI: | 7.648 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4845 | ||
| Instability index: | 26.959 | ||
| aromaticity | 0.045 | ||
| GRAVY | 0.222 | ||
Secondary Structure Fraction | |||
| Helix | 0.294 | ||
| turn | 0.254 | ||
| sheet | 0.237 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143081.1 | 3prime_partial | 177 | 35-565(+) |
Amino Acid sequence : | |||
| MESIPVIARKLEGKVAVITGGASGIGECTARLFCRHGAKVVIADVQEELGRSVSNDLGSAASFIHCDVTNEDDISKAVDYAVDKFGKLDIMFNNAGITGKIGQSVLEYTKSDLEHILGVN LIGPFLGTKHAARVMIPARCRGSIISMSSIASVNAGITPHGYACSKHGVVGLTKCAA | |||
Physicochemical properties | |||
| Number of amino acids: | 177 | ||
| Molecular weight: | 18,472.115 | ||
| Theoretical pI: | 7.648 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4845 | ||
| Instability index: | 26.959 | ||
| aromaticity | 0.045 | ||
| GRAVY | 0.222 | ||
Secondary Structure Fraction | |||
| Helix | 0.294 | ||
| turn | 0.254 | ||
| sheet | 0.237 | ||