Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143090.1 | internal | 206 | 1-618(+) |
Amino Acid sequence : | |||
DARSDQINREEQQQEKLRLKYLDFVHVAAIQALFFLSRLYDFAKDNSGPLKPGVQSVEGTVKAVVGPVYEKFHGVPFELLTFVDCKVGESIGEIKRHVPLPLKDATNKARSFSSEAQRAG LVGTATCLARAAYTKAEPTAKVLYQRYAPVAEQYAVSAWRSLNRLPVFPQVAQIVVPTAAYWSDKYNKIVCSSAEKGYAVSAYLPL | |||
Physicochemical properties | |||
Number of amino acids: | 206 | ||
Molecular weight: | 12,716.115 | ||
Theoretical pI: | 11.888 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 29240 | ||
Instability index: | 84.022 | ||
aromaticity | 0.054 | ||
GRAVY | -1.404 | ||
Secondary Structure Fraction | |||
Helix | 0.107 | ||
turn | 0.304 | ||
sheet | 0.161 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143090.1 | 5prime_partial | 112 | 619-281(-) |
Amino Acid sequence : | |||
QGGDTPRQRIPSRLTSRRSCCTCRTNRRQSGRQSGRPGGTPGAGSGTAMPRPRTALPQARTSGTEPWRLARPWYRQHGQDRWQCRQGRHAGLRWRRTGPCWLHPSMEEARDA* | |||
Physicochemical properties | |||
Number of amino acids: | 112 | ||
Molecular weight: | 12,716.115 | ||
Theoretical pI: | 11.888 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 29240 | ||
Instability index: | 84.022 | ||
aromaticity | 0.054 | ||
GRAVY | -1.404 | ||
Secondary Structure Fraction | |||
Helix | 0.107 | ||
turn | 0.304 | ||
sheet | 0.161 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143090.1 | internal | 206 | 1-618(+) |
Amino Acid sequence : | |||
DARSDQINREEQQQEKLRLKYLDFVHVAAIQALFFLSRLYDFAKDNSGPLKPGVQSVEGTVKAVVGPVYEKFHGVPFELLTFVDCKVGESIGEIKRHVPLPLKDATNKARSFSSEAQRAG LVGTATCLARAAYTKAEPTAKVLYQRYAPVAEQYAVSAWRSLNRLPVFPQVAQIVVPTAAYWSDKYNKIVCSSAEKGYAVSAYLPL | |||
Physicochemical properties | |||
Number of amino acids: | 206 | ||
Molecular weight: | 12,716.115 | ||
Theoretical pI: | 11.888 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 29240 | ||
Instability index: | 84.022 | ||
aromaticity | 0.054 | ||
GRAVY | -1.404 | ||
Secondary Structure Fraction | |||
Helix | 0.107 | ||
turn | 0.304 | ||
sheet | 0.161 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>EX143090.1 | 5prime_partial | 112 | 619-281(-) |
Amino Acid sequence : | |||
QGGDTPRQRIPSRLTSRRSCCTCRTNRRQSGRQSGRPGGTPGAGSGTAMPRPRTALPQARTSGTEPWRLARPWYRQHGQDRWQCRQGRHAGLRWRRTGPCWLHPSMEEARDA* | |||
Physicochemical properties | |||
Number of amino acids: | 112 | ||
Molecular weight: | 12,716.115 | ||
Theoretical pI: | 11.888 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 29240 | ||
Instability index: | 84.022 | ||
aromaticity | 0.054 | ||
GRAVY | -1.404 | ||
Secondary Structure Fraction | |||
Helix | 0.107 | ||
turn | 0.304 | ||
sheet | 0.161 |