| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143090.1 | internal | 206 | 1-618(+) |
Amino Acid sequence : | |||
| DARSDQINREEQQQEKLRLKYLDFVHVAAIQALFFLSRLYDFAKDNSGPLKPGVQSVEGTVKAVVGPVYEKFHGVPFELLTFVDCKVGESIGEIKRHVPLPLKDATNKARSFSSEAQRAG LVGTATCLARAAYTKAEPTAKVLYQRYAPVAEQYAVSAWRSLNRLPVFPQVAQIVVPTAAYWSDKYNKIVCSSAEKGYAVSAYLPL | |||
Physicochemical properties | |||
| Number of amino acids: | 206 | ||
| Molecular weight: | 12,716.115 | ||
| Theoretical pI: | 11.888 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 29240 | ||
| Instability index: | 84.022 | ||
| aromaticity | 0.054 | ||
| GRAVY | -1.404 | ||
Secondary Structure Fraction | |||
| Helix | 0.107 | ||
| turn | 0.304 | ||
| sheet | 0.161 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143090.1 | 5prime_partial | 112 | 619-281(-) |
Amino Acid sequence : | |||
| QGGDTPRQRIPSRLTSRRSCCTCRTNRRQSGRQSGRPGGTPGAGSGTAMPRPRTALPQARTSGTEPWRLARPWYRQHGQDRWQCRQGRHAGLRWRRTGPCWLHPSMEEARDA* | |||
Physicochemical properties | |||
| Number of amino acids: | 112 | ||
| Molecular weight: | 12,716.115 | ||
| Theoretical pI: | 11.888 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 29240 | ||
| Instability index: | 84.022 | ||
| aromaticity | 0.054 | ||
| GRAVY | -1.404 | ||
Secondary Structure Fraction | |||
| Helix | 0.107 | ||
| turn | 0.304 | ||
| sheet | 0.161 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143090.1 | internal | 206 | 1-618(+) |
Amino Acid sequence : | |||
| DARSDQINREEQQQEKLRLKYLDFVHVAAIQALFFLSRLYDFAKDNSGPLKPGVQSVEGTVKAVVGPVYEKFHGVPFELLTFVDCKVGESIGEIKRHVPLPLKDATNKARSFSSEAQRAG LVGTATCLARAAYTKAEPTAKVLYQRYAPVAEQYAVSAWRSLNRLPVFPQVAQIVVPTAAYWSDKYNKIVCSSAEKGYAVSAYLPL | |||
Physicochemical properties | |||
| Number of amino acids: | 206 | ||
| Molecular weight: | 12,716.115 | ||
| Theoretical pI: | 11.888 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 29240 | ||
| Instability index: | 84.022 | ||
| aromaticity | 0.054 | ||
| GRAVY | -1.404 | ||
Secondary Structure Fraction | |||
| Helix | 0.107 | ||
| turn | 0.304 | ||
| sheet | 0.161 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143090.1 | 5prime_partial | 112 | 619-281(-) |
Amino Acid sequence : | |||
| QGGDTPRQRIPSRLTSRRSCCTCRTNRRQSGRQSGRPGGTPGAGSGTAMPRPRTALPQARTSGTEPWRLARPWYRQHGQDRWQCRQGRHAGLRWRRTGPCWLHPSMEEARDA* | |||
Physicochemical properties | |||
| Number of amino acids: | 112 | ||
| Molecular weight: | 12,716.115 | ||
| Theoretical pI: | 11.888 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28990 29240 | ||
| Instability index: | 84.022 | ||
| aromaticity | 0.054 | ||
| GRAVY | -1.404 | ||
Secondary Structure Fraction | |||
| Helix | 0.107 | ||
| turn | 0.304 | ||
| sheet | 0.161 | ||