| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143106.1 | internal | 111 | 1-333(+) |
Amino Acid sequence : | |||
| SDMERLHRIFGMGHTPTDSPLLDSSEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDEYTVRVVDVFAMPQSGTGVSVEAVDHVFQTNMLDMLKQTGRPEMVVGWYHS | |||
Physicochemical properties | |||
| Number of amino acids: | 111 | ||
| Molecular weight: | 12,371.174 | ||
| Theoretical pI: | 5.159 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
| Instability index: | 30.392 | ||
| aromaticity | 0.072 | ||
| GRAVY | 0.019 | ||
Secondary Structure Fraction | |||
| Helix | 0.315 | ||
| turn | 0.225 | ||
| sheet | 0.288 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >EX143106.1 | internal | 111 | 1-333(+) |
Amino Acid sequence : | |||
| SDMERLHRIFGMGHTPTDSPLLDSSEQVYISSLALLKMLKHGRAGVPMEVMGLMLGEFVDEYTVRVVDVFAMPQSGTGVSVEAVDHVFQTNMLDMLKQTGRPEMVVGWYHS | |||
Physicochemical properties | |||
| Number of amino acids: | 111 | ||
| Molecular weight: | 12,371.174 | ||
| Theoretical pI: | 5.159 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 9970 | ||
| Instability index: | 30.392 | ||
| aromaticity | 0.072 | ||
| GRAVY | 0.019 | ||
Secondary Structure Fraction | |||
| Helix | 0.315 | ||
| turn | 0.225 | ||
| sheet | 0.288 | ||